Open Close
General Information
Symbol
Dmel\CG4678-PJ
Species
D. melanogaster
Annotation Symbol
CG4678-PJ
FlyBase ID
FBpp0308861
Associated gene
Length (aa)
523
Theoretical pI
7.44
Predicted MW (kDa)
58.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MILRTPLVAGHQLQLLLLPSVLLLMLHLLLCDAKTVNPGDSMQMQHHQMTAEPGLPEPRAYMPDAQHLDFVYHDHEELTR
FLRATSARYPNLTALYSIGKSIQGRDLWVMVVSSSPYEHMVGKPDVKYVGNIHGNEPVGREMLLHLIQYFVTSYNTDQYV
KWLLDNTRIHILPTMNPDGYAVSKEGTCDGGQGRYNARGFDLNRNFPDYFKQNNKRGQPETDSVKDWISKIQFVLSGSLH
GGALVASYPYDNTPNSRICRSSALCAMFQTYSAAPSLTPDDDVFKHLSLVYARNHAKMSRGVACKSATPAFENGITNGAA
WYPLTGGMQDYNYVWYGCMEITLEISCCKFPPAYELKKYWEDNQLSLIKFLAEAHRGVQGFVFDPAGMPIERASIKIKGR
DVGFQTTKYGEFWRILLPGYYKVEVFAEGFAPREVEFVIVEQHPTLLNVTLQPSKRLEGIGPMGPGGVPVGGVVGPGGLY
RPIPSPQHYRPPVPPYAGAASSDSGIFSTISNGLNSLYSNIFG
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0339827
1982
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0300032
2007
FBtr0300033
1994
FBtr0300034
1875
FBtr0300035
1902
FBtr0308847
1952
FBtr0339828
1670
FBtr0339829
2062
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0289309
518
FBpp0289310
527
FBpp0289311
479
FBpp0289312
488
FBpp0301002
513
FBpp0308862
404
FBpp0308863
474
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG4678-PJ
Name Synonyms
Secondary FlyBase IDs
    References (0)