Open Close
General Information
Symbol
Dmel\CG42258-PE
Species
D. melanogaster
Annotation Symbol
CG42258-PE
FlyBase ID
FBpp0308871
Associated gene
Length (aa)
175
Theoretical pI
6.50
Predicted MW (kDa)
17.8
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MATTAAGIQQQQVIGLGAAYDRQQSTDSGWDNPFRPGGDLSREADEIVNMIRGGKPITPTEERTIGNGSAQHADDNCNGG
TAIGESVIKSNGLCHLQLSQNLATAQNGTNSHASATADAGAGKAATATELSGGTGNNGVTSLGQVSKQVVPGPTSASHVV
IDEKKNKKKGCCVLQ
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0339839
1648
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0299558
3827
FBtr0299559
1806
FBtr0339840
2740
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0288833
465
FBpp0288834
169
FBpp0308872
169
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG42258-PE
Name Synonyms
Secondary FlyBase IDs
    References (0)