Open Close
General Information
Symbol
Dmel\Usp16-45-PF
Species
D. melanogaster
Annotation Symbol
CG4165-PF
FlyBase ID
FBpp0309404
Associated gene
Length (aa)
1126
Theoretical pI
6.55
Predicted MW (kDa)
121.5
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MVKKRQADSRDHDCSTDSGNEDLHHRKGLGSPGQSDGATPTTASCQHIKKAVDAARLRRLLKSTGLLYECSQCQKLGKTA
GSAAGAGASEGAVGPGGNPVTFEFDNTLWLCLKCGSQLCGRARHKHALEHYQTPHSDSHALAMNTRSFDIWCYECDMKIC
SNLRKNLLECVELVKKLAQKPPTSTVTPSTPTISYIEEKLKAALEHLTPIVPMTGGSFDDSSSRGSLAAAGGGGGVGSSR
NRQVAIPMPPPEPSSGLSTSDSLTSVPGMAKRIDQYSATTNGNTGNKRLLTLETPRIENERLPRVRGLTNLGNTCFFNAV
MQCLAQTPFLLSVLKELSEPGEEFILPGGTFTIKDKGDIELPMIKGTLSSWGGLTAALANALEELQAGGSVFTPRKLFDR
LCVKCPQFTGGDQHDAHELLRQLLESVRNEDLKRYQRVILQNLGYKDQDVNSVSEEMRQKCKIYGNQAGDRILRPEQVFR
GFLVSTLTCQDCHNVSSRHEYFLDMSLPVAVEKPQPPQRRKPSPELSLTSSSSSVTPSTGQPTINTKFTDGSVNFTASSP
SFFLHAHEAASLGPSKSQVKKEKERQRKAKRAAKKRQKSSLNLNGNDSGNGNELAESVDQDDASLASLGAGDGQANDGLE
QTNGQTEDSTTSSVTTSEHSDADVEDNLVEDTAAPSTNNVPSSTASLTAPSKTYMDSNGNAQPPGEKRDDTPEHMDKDSL
EEDENDSGIATSPAPTATNSSTSTSATGNNNSVAGSGLSGSSGALEDPLAPASLVTAGLSEKGASVIRQVSVGAEQGASN
GTEDADGEAKAIEQPEKTPSQAQAMAQAQARTKRVRTQSYSDWSTTIAPRYQCEDGECSVQSCLNNFTAVELMTGQNKVG
CDSCTQRINGSDPKAKSVNTNATKQLLVSSPPAVLILHLKRFQLGPRCIFRKLTRPVSYPNLLDIAAFCGSKVKNLPNID
RKQKKLLYALYGVVEHSGGMYGGHYTAYVKVRPKVAPGDKRWKFLPHGSKAELDQDDDQLKKLEELLAKEKAREQHLKVL
DDSDDFSNSSSNSSTSDESQTPATPLEEQQTQQAQQPQQPQQLEEAANVRAPPGKWYYVSDSRVQEVSEDTALKAQAYLL
FYERIY
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0340462
4454
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0070773
4141
FBtr0070775
4066
FBtr0070772
4117
FBtr0340461
4093
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0070739
1126
FBpp0070741
1126
FBpp0070738
1126
FBpp0309403
1126
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG4165-PF
Usp16-45-PF
Name Synonyms
Secondary FlyBase IDs
    References (0)