Open Close
General Information
Symbol
Dmel\CG43658-PG
Species
D. melanogaster
Annotation Symbol
CG43658-PG
FlyBase ID
FBpp0309639
Associated gene
Length (aa)
1563
Theoretical pI
9.19
Predicted MW (kDa)
169.5
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MIMRRASACTMPSSGGGGGAGVGSSQREEATTPGESPGGRLSRWFSIRRGSSHQYDVGGRDGRHSTASSFDTPDSGSGNS
PKNGSNAVAGTGGAGSQGVALDAASPQKLANLGASKMMPGVPESEDDEATANRFDVDLMMTPGSRANGTARTAHNRLIVP
MLPPAPAGLSQQQLKRRHIVAAIVHSENSYVATLQRLVNDYKKPLEECSPPVLNPVKIATLFHCLPDILHSHKLFRISLA
ECVRNWDRDEKIGDCFVSAFGKPQLLEIYSGFINNFSAAMELAKMEEKRKSALADFFKVKQISAHDRLSFFGLMVKPVQR
FPQFILFLQDLLKYTPQGHHDRMSLQLALSQLELLAELLNESKREAEQYQAFKEMLGHISGTFNARSLSLSSVSVSDSAG
GHRPRYLLREDNVTHMEFNQAGFIVKCKQRRLLLLNDKVICVSVAPKQSHDFGATEKLTFKWMFPVNDVEIVDNSTSATL
SRILTAGLNRGGSLKSNGSSGANGSPYANSTLPGHGGGVSGFSGFGDPHSSPAAQLTNGADNLCSEMSTLMYDYEVISRI
QDLVSSLKGSYKELNANTTRNVLNLIQGSIQRKDEEMAWVDSCCLQLIGRHKSGKEETFTFQTQTPAVKKEWITELRLAQ
LALDPNNSPAWERGGSHPQPAHHHPHHHPLQHPHAGAGDPRQTQEQLQLQEAVQQKQSRKMPLFVKAMPVYKSQHQTEVR
CGCYYSIANDTKQSGNARRRHKQLNYLWMCSSDGTSSHITVLAQHPQQAGNLREAGAFDLFETQVSALEFVKGLDQLKSR
DEPASLLGDLVWLGTDSRKILIYSARNPEQEEQLGSYSVPGAVQRILYHFDAVYVALSGATVLIFRRGNDGVWQLRDPQT
IRLGDTDLVVPSLLPINMCIYASCGNRVYVMNALNGEIQRSFEVQHGATQQVNLMAHSGIGLWISLKNSTMLCLYHTETF
KHLQDINIASSVLRHDGKKEQPLNNSSVYVTALMACKGLLWVGTNVGIAVTIPLPRLEGVPIISGGINMSCHAHFGPITF
LLPLIPKVYPAYKPPTVGAAPLVPSMGDDLQLPAIDADPKIQELDDGAVVLRRDLAKEEMSSSNPGADSTASSPRSSKLD
KQNSLDQSFTAKIRASLANSPAFHRKRFRDDPNRMSKTLPRGLGAAAAGSGAGGASAAGSGTASGNTSQHGEHGICDVYG
LYGKLIFVKEDYDAEEGNQGNLMDMMYEGMRRSDPELAAIPGKVCTLDRRLRMKASRPRSLDLSNWSVDSKSSSLYTSSG
SEESMGIRHFGGRSVSRNSSSASHKTSGTGSDLGNISENGLMTTADIHHHQQQQQQLNSSAKPDEMSRLGAGNSGLDKPA
AAVATLKRKQKQNSKQQQQQNADGPRTVITLMGGRGYWRQMWYNGAGGSPSHKNSSSGGGGGSGSGFSGQTMQSGNPSCS
PLTANSNDAHIVVWEKKLXSQELVCCCTLQQHPHQHHPPLTELWRRVGEQHQQHQQLQQAQRRGRGRVRFRGSFIQRDRS
AGSDGGSGYGSGGLSGAGGSGGMLGASLKRLTKLKRGGSLKEF
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0342802
7249
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0310336
7067
FBtr0310337
7249
FBtr0310335
9857
FBtr0310338
7090
FBtr0310339
7877
FBtr0330597
7067
FBtr0342803
7346
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0302019
1458
FBpp0302020
1458
FBpp0302018
2263
FBpp0302021
1736
FBpp0302022
1458
FBpp0303448
1563
FBpp0309640
1458
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG43658-PG
Name Synonyms
Secondary FlyBase IDs
    References (0)