Open Close
General Information
Symbol
Dmel\trol-PAX
Species
D. melanogaster
Annotation Symbol
CG33950-PAX
FlyBase ID
FBpp0309659
Associated gene
Length (aa)
2853
Theoretical pI
4.49
Predicted MW (kDa)
316.8
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MMGSPGSQASAIATSVGIRSGRRGQAGGSLLLRLLAVTFVLAACHAPLLTNAKQISNLGDDQDFMLADDESLQGINDSEW
QLMGDDIDDGLLDDVDETLKPMETKSEEEDLPTGNWFSQSVHRVRRSINRLFGSDDNQERGRRQQRERSQRNRDAINRQK
ELRRRQKEDHNRWKQMRMERQLEKQRLVKRTNHVVFNRATDPRKRASDLYDENEASGYHEEDTTLYRTYFVVNEPYDNEY
RDRESVQFQNLQKLLDDDLRNFFHSNYEGNDDEEQEIRSTLERVEIELPTSVNDFGSKLQQQLNVYNRIENLSAATDGVF
SFTESSVTEESVRHLDVGFVEPHITLFHEQNTGYDDFDRKPTTETQDIEEEAIDVTLPQEEVEGSGSDDSSCRGDATFTC
PRSGKTICDEMRCDREIQCPDGEDEEYCNYPNVCTEDQFKCDDKCLELKKRCDGSIDCLDQTDEAGCINAPEPEPEPEPE
PEPEPESEPEAEPEPEPEPEPESEPEQEPEPQVPEANECQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEECRCYANQ
FRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPN
QLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRNGRLEIPNIRVEDAGTYVCEAVGYASYIPG
QQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQSCSLGLKCQPNQFMCSNSKCVDRTW
RCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQSVSLLEYEV
LELTCVATGTPTPTIVWRLNWGHVPDKCESKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDV
CEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRA
TNVHFSGRETPYLALPADYMGNQLKSYGGNLRYEVNYRGSGRPVNGPDVIITGNRFTLTYRVRTQPGQNNRVSIPFVPGG
WQKPDGRKASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCESCAS
GYVRQPGGPWLGHCVPFIPDSCPSGTYGDPRRGVPCKECPCPLTGSNNFASGCQQSPDGDVVCRCNEGYTGRRCEQCAAG
YQGNPLAAGGICRRIPDTSCNVDGTYSVHSNGTCQCKDSVIGEQCDTCKSKSFHLNSFTYTGCIECFCSGVGLDCDSSTW
YRDQVTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMAAEPNALSFIGSADQSGNTLYWSLPAAFLGNKLSSYGGKLTYTL
SYSPLPNGIMSRNSAPDVVIKSGEDLRLIHYRKSQVVPSVANTYSVEIKESAWQRGDEVVANREHVLMALSDITAIYIKA
TYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCEQCAPGYARDPEGGIYLGLCRPCECNGHSKYCNS
DTGDCEECSDNTEGPSCERCAAGYVGDATRGTIYDCQPDEGYPIPSPPAPGNQTLECTAYCQIEGIYDCRGNECLCKRNV
IGDQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALYRQLIPVDFILNAPLITDESGAVQDTENLIPDISRNMYTY
THTSYLPKYWSLRGSVLGNQLFSYGGRLSYSLIVESYGNYERGHDIVLIGNGLKLIWSRPDGNENQEEYNVRLHEDEQWT
RQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDIELCQCPSGYVGTSCESCA
PLHYRDASGSCSLCPCDVSNTESCDLVSGGYVECRCKARWKGDRCREIDTNDPTDIGTEDPVLTQIIVSIQKPEITIVPV
GGSMTLSCSGRMRWSNSPVIVNWYKENSRLPENVEVQGGNLYLYDLQVSDSGVYICQAVNNETASVFKDTVSITITKKDQ
LSPAEIVNLPSHVTFEEYVNNEIICEVLGNPAPRVTWARVDGHADAQSTRTYDNRLIFDSPRKSDEGRYRCQAENDQNRD
EKYVIVYVQSNPPQPPPQQDRLYITPEEINGLAGESFQLNCQFTSVASLRYDWSHNGRSLSSSPARNVEIRGNTLEVRDA
SESDSGVYTCVAYDVRTRRNFTESARVNIDRREEQPFGNKPIIESLEQNILIIQGEDYSITCEASGSPYPSIKWAKVHDF
MPENVHISGNVLTIYGARFENRGVYSCVAENDHGSDLSSTSIDIEPRERPSVKIVSAPLQTFSVGAPASLYCTVEGIPDP
TVEWVRVDGQPLSPRHKIQSPGYMVIDDIQLEDSGDYECRAKNIVGEATGVATITVQEPTLVQIIPDNRDLRLTEGDELS
LTCVGSGVPNPEVEWVNEMALKRDLYSPPSNTAILKIYRVTKADAGIYTCHGKNEAGSDEAHVRVEVQERRGDIGGVDDD
SDRDPINYNPPQQQNPGIHQPGSNQLLATDIGDNVTLTCDMFQPLNTRWERVDGAPLPRNAYTIKNRLEIVRVEQQNLGQ
YRCNGIGRDGNVKTYFVKELVLMPLPRIRFYPNIPLTVEAGQNLDVHCQVENVRPEDVHWSTDNNRPLPSSVRIVGSVLR
FVSITQAAAGEYRCSAFNQYGNRSQIARVAVKKPADFHQVPQSQLQRHREGENIQLQCTVTDQYGVRAQDNVEFNWFRDD
RRPLPNNARTDSQILVLTNLRPEDAGRYICNSYDVDRGQQLPEVSIDLQVLSE
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0342823
13213
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0342806
14181
FBtr0342807
10611
FBtr0342808
13564
FBtr0342809
12022
FBtr0342810
12866
FBtr0342811
11515
FBtr0342812
12232
FBtr0342813
12679
FBtr0342814
12540
FBtr0342815
11749
FBtr0342816
13776
FBtr0342817
12781
FBtr0342818
12294
FBtr0342819
13666
FBtr0342820
14232
FBtr0342821
12798
FBtr0342822
12900
FBtr0342824
12378
FBtr0342825
12846
FBtr0342826
13488
FBtr0475303
13023
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0309642
4434
FBpp0309643
3105
FBpp0309644
4411
FBpp0309645
3897
FBpp0309646
4176
FBpp0309647
3728
FBpp0309648
3967
FBpp0309649
4150
FBpp0309650
3887
FBpp0309651
3806
FBpp0309652
4299
FBpp0309653
4150
FBpp0309654
3805
FBpp0309655
4479
FBpp0309656
4451
FBpp0309657
3973
FBpp0309658
4007
FBpp0309660
3833
FBpp0309661
3989
FBpp0309662
4203
FBpp0423412
4178
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
trol-PAX
Name Synonyms
Secondary FlyBase IDs
    References (0)