Open Close
General Information
Symbol
Dmel\CG44838-PG
Species
D. melanogaster
Annotation Symbol
CG44838-PG
FlyBase ID
FBpp0310157
Associated gene
Length (aa)
783
Theoretical pI
7.88
Predicted MW (kDa)
82.7
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSCISSNFSSFFLNSLNDPSEFSKYLSNGELKCTNFEEFQVFGCGAGAATQQQQQQQHQQYSHTHLPNGSSATAAADFPN
YEATTTPQRENSSSVNSGSSVNPAHYASAAASASASVEASASAAPTSTPGIAGAAGSTSLTATPSSNRWPTAVATPNGHQ
STASTAGSVPQHFDGSFEFIKYLRHSTDFTPSTPSSATETSSCAEKQVSVSKSGVQAGATPPPPAQSPVAGGLIDLDTST
SQKSRSASRKVAALLSSVSRASNSLVDTSSSALDVFDHDSKQTIFDLQHIASNGSSNSNESSLEMLAFPNSHLNASNSNT
SSEGAACGSAGEFGGLLTGASCSSSTASSSSHAPKLLGSFVIKENFEVHPSHKVEEGIFQHMNKLPSKKKDTLKQLGVRF
TGQMTLTDKSIVVENFIKFCEEYDIKDHRPWLSLNQCGLNKPEQIKFARYLGQGLPTFTLFCIYSNFKNLFCTKRTEIYT
KDGYNLPYILDKTKRFLANTTAGDNTNNNITNNTSNKTNNNTSTTTTSTPVKQTPQQQHQQQSEQDPLAPNSPATPKLAA
AAASAATATPATPVATSMLGAATPAQAVPRTRPATPTMPAGAVAGTPTTPQHQQQQHLHQQHQQQQQQQQQQQQQQHMLQ
HPHTHPHPHAQHSHPHTLPHSLPHHLQPGTPTRSSHPQLQHPHHYPPSPHSHPHHQTGHHGLPHAHHFAYAHGHPHPQQH
HPHYYPHPHAHVQHMAAMGYPGPPPNAQQAVGGGGVGGGGAGGATGGAGSAGGGGGPLPPTAM
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0343556
5029
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0343555
4766
FBtr0343559
5524
FBtr0343560
3089
FBtr0343557
3263
FBtr0343558
3758
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0310156
783
FBpp0310160
828
FBpp0310161
783
FBpp0310158
783
FBpp0310159
828
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG44838-PG
Name Synonyms
Secondary FlyBase IDs
    References (0)