Open Close
General Information
Symbol
Dmel\Fer2-PD
Species
D. melanogaster
Annotation Symbol
CG5952-PD
FlyBase ID
FBpp0310462
Associated gene
Length (aa)
283
Theoretical pI
8.29
Predicted MW (kDa)
29.8
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSRNQLPDSSSSPPISHLPFHNFDDDLINDLPSCIYAGQHQGGGATGGGGGSGGGGGSSGLRLSSNNLRHIQQHYMQHSG
ENLLDSSTNPMGVHNSGGGAPLMCNSPSASSSGGGCGNAGSATPGGAGGPNPGYGSVGAATASSYKMQRQAANVRERKRI
QRSAPTGYTKCSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLLREVLQTDYDPLTYVEKCLRGEIKADRANWNT
SDLTARLSWINWENLGVHPGRRTLLTSLALSSEPMCGAHCGMP
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0344011
1363
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0301709
1336
FBtr0344010
1351
FBtr0344012
1333
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0290923
274
FBpp0310461
279
FBpp0310463
273
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
Fer2-PD
Name Synonyms
Secondary FlyBase IDs
    References (0)