Open Close
General Information
Symbol
Dmel\CG42709-PD
Species
D. melanogaster
Annotation Symbol
CG42709-PD
FlyBase ID
FBpp0310627
Associated gene
Length (aa)
457
Theoretical pI
4.92
Predicted MW (kDa)
50.5
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MHVYYKFGLLLIFLLSVSISHTNAAPAGSEEANPLEDFNYGDDDYSETATGEESPETAENRLMPQSSSTSTTTTFRPIFN
IPRRSNHVLEPSCPRNCLCLEDFKFVQCANAHLTHVPLDMPKTAAIIDLSHNVIAELRPEDFANLSRAVEINLNHNLISS
IDKDVFQGSERLKRLRLANNRLTKIDPDTFAAAKELTLLDLSNNTITQRLDGSFLNQPDLVEFSCVNCSWTELPEQTFQN
MSGLEVLRLNKNDFKQQINTKAFSPLTKIIKLKLPELEQQNIEELCSLLTSIDTISFLNYDISCYEFVLGTPFNGSLIYP
TEPPLKGITNPPIVASITSTAKPVTATPAPPRTNRNRGKMDNSTELVKAGILSSETSTSGVSVEPPAESQTNQVQISQEA
INTLLICIMVLAVIGIVIGLICRQDIGGIKTKCCRTSKPEPKDQVHPTEEIPLNKLA
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0344221
2050
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0302980
2186
FBtr0302981
2212
FBtr0302982
2053
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0292105
458
FBpp0292106
458
FBpp0292107
458
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG42709-PD
Name Synonyms
Secondary FlyBase IDs
    References (0)