Open Close
General Information
Symbol
Dmel\DPCoAC-PF
Species
D. melanogaster
Annotation Symbol
CG4241-PF
FlyBase ID
FBpp0310687
Associated gene
Length (aa)
365
Theoretical pI
10.44
Predicted MW (kDa)
40.4
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSRLLEKPNIAMSIKSTGSQLSSTMTTASATLSSDLDDADTSRTQLSPSETSGVVLVPATTVTPMRQKIDQVVISLISGA
AAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTYANEGVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHV
DKDGTNTKGRRFLAGSLAGITSQSLTYPLDLARARMAVTDRYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAG
TSFFTYETLKREYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIYREEG
VKNGFYKGLSMNWIKGPIAVGISFSTYDLIKAWLTELANLRRVEK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0344282
2089
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0089480
1654
FBtr0089481
1336
FBtr0089482
1898
FBtr0344280
1901
FBtr0344281
1440
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0088485
365
FBpp0088486
290
FBpp0088980
365
FBpp0310685
364
FBpp0310686
290
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
DPCoAC-PF
att-ORFA-PF
Name Synonyms
Secondary FlyBase IDs
    References (0)