Open Close
General Information
Symbol
Dmel\Thd1-PC
Species
D. melanogaster
Annotation Symbol
CG1981-PC
FlyBase ID
FBpp0311396
Associated gene
Length (aa)
1738
Theoretical pI
6.95
Predicted MW (kDa)
191.4
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MQEESGSTPLLSSSFSYTPTVAPLVLKIALIQAARSFAASKYTIKVLLSLNLALSEQAIVQKAVKPICTVMASEVDASSG
PEDGTVPTLMSLTPYITNLEHGNNESGKYVSGLPNNRKRQKLSILEHNTIQNNDVDNTEVEPNMDPKSKMSDTKSNKYSE
MEKHLNDNSKIVIEGTISIGNSKRKSPEKLVPYDNDCYMPPEQALVTSVELVVPAPQTHSSNTPGRQSEEPNLSTLGESS
TTPSSTIDNKLQYSTAGLYNSTSSTSILANDKIVGCANDSSNLNLRIPTKLVVTTASGDILIDDRRASLWTPHHDESGQR
QQRTGTASSDTKQEPMNVSSELSYHHQNRHSELLLQIEKESSGSFLQASPIPLQDNHNNAASGQFGQTEETSNIDSQSHN
NFYAQMMQPQHLLHNQHQQSMHEHSPRHQQPASYSGYITHYQNPPMFGAHQSEHHQRLNQQQQPLQHLLDCHGHLEQSTP
ISQQNQHHLSQQIHQHQHQQTHQRLPLRENYHDIIMDDFHEEPSHAFKLTLSPSNTKPENQDDGYETSAGDVLTPNSHSS
STHSITPQHQMQHSNIVLMTQNQKKSDDLQLTKVTLSGEAHTDPNACSSNSSQGQVLASQSHLELSEGTRCSSHASVVDP
YSFMGEELHMHSPSHRHLDAVTTGPGRYGILVSNDTPECLSREMYRHSQQSTTVLEQTDSSSCGINFKPMPKKRGRKKKL
VAVNADTSQMTTPVDQQKVSAGRADCEDGGGDQAAKPKERKKHDRFNGMSEEEVIKRTIPDHLCDNLDIVIVGINPGLFA
AYKGHHYAGPGNHFWKCLYLAGLTQEQMSADEDHKLIKQGIGFTNMVARATKGSADLTRKEIKEGSRILLEKLQRFRPKV
AVFNGKLIFEVFSGKKEFHFGRQPDRVDGTDTFIWVMPSSSARCAQLPRAADKVPFYAALKKFRDFLNGQIPHIDESECV
FTDQRIRLCSAQQQVDIVGKINKTHQPPLGDHPSSLTVVSNCSGPIAGDAECGIVAEESDQVQSEKMIPQMDPTVPSSSN
ATDGKSFSYTAENTPLLPVSNHNPSINENNYLSVMGSQQPLSQQPLEKKKRGRPKKIKGQDIIDHSVGGKASIAGQHIPS
HDFNNILNLSVMSGGGTIETPKKKRGRPKKLKPAIDNIMTVKQLQHGNNNLNTTAGLSASSMHPISMEHIAASPQSSHQM
PPSLYNTPPPSHLLYTASASPMASPALNCNYTQVHGHGTPPVGQVASVAQGSSPVIDTQNDHLAQQKQSHHGNLGAGLDM
RDHPHLGETPPPSSPNMCSTVDFDPPDEHSGSQVGSRVQNKAVELDHQHPQIMEKVQYDSPVPNTEANPAHPHENYQQWL
SPHPHQSNQPAQKLTHRQQHPPMHHFHQEQTENWQRYEEQNSNPYMVISAHHQHLSPRLGNQTHQNSSPSGHISSDVAHK
SLCGLESLVDQIPAIREQDCSNIPLATVAAAAAAVESRILSLQHQHQHPLQPHQQNQQNQQQQLKQCKQENSAHRESCRP
TSENSNVSNSNFSVSSLAASASSARTDNAIYGNGETKGNNESSHHNSCDTNIDYPIHNQSAYHHTPHLIGSALGTNVNNS
EPNLHTISHPHPPHPHPHSMYVDQAHHMAHIPSVNVNSMYGPAYGSHPQHTTGEYPGTHGHYSLGGSVQTAVPTSSATLH
VPSPNYPFGHHPYGHTPPQANYPSYTHPHTHHHHSHPSHHLTVFDHLKPSDISGYGGF
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0345197
13125
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0089106
6189
FBtr0333706
10897
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0088175
1738
FBpp0305856
1738
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
Thd1-PC
Name Synonyms
Secondary FlyBase IDs
    References (0)