Open Close
General Information
Symbol
Dmel\CG34451-PC
Species
D. melanogaster
Annotation Symbol
CG34451-PC
FlyBase ID
FBpp0311794
Associated gene
Length (aa)
253
Theoretical pI
6.51
Predicted MW (kDa)
30.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MIPYNYNSPDTAKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVINSTDTWTLVQQGLMQAYLFYADQIDWFLRVEPSSFV
VLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISREALRRYTMASKDPENKECTHWEGYVEGLDIHRCL
RFANVTVAESRDEFEHETFLPVTMDYQFLNGYDTIPWLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKI
FGTPVRNSIDFRP
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0345808
1193
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0112757
966
FBtr0308640
1275
FBtr0479781
966
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0111669
253
FBpp0300863
166
FBpp0428114
307
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG34451-PC
Name Synonyms
Secondary FlyBase IDs
    References (0)