Open Close
General Information
Symbol
Dmel\CG46025-PD
Species
D. melanogaster
Annotation Symbol
CG46025-PD
FlyBase ID
FBpp0312501
Associated gene
Length (aa)
596
Theoretical pI
4.86
Predicted MW (kDa)
68.5
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSLTAMKSDAAGIGVVGVGGTVALSDSREWAPPPPGNRCATVTMLLAQRIARNACWSVDEEPSYSANKMNVWQTLEYLSG
LSLRKKYNYEGFSDTQNVIRTLTPSWRRDSFAEKAKAEELTGGAAASTVKYTDERSSSAPIIVIQDPGISTSFQSSDNVA
LGVRSRAKSPSGLRRKHRSRKRNTPQLDPEYALSPEDLQDLVKCNFNLPRISARLERLMGTNVVKLTDRSYMKELRERID
EDYRKQLLSRIRARELKEVERERMLIIEGKSDVIPDELANDPIFMVNKDANMEIQKERSKLKTAREKNAERLKLQGVKWE
RERLQHAAKEAELLAKKRERHRQQKLLVEQYRTEDAERGMDLLRIDNEDWRECEKSLKEFLEQERAKMKERSLRISQPYS
SDPQDIQNIVRARQKFRETELRIRNQLEDKLKDVKLAVTTQQLTELIEDAHRSSGEIIMPQEPSMEDDDFQGGAVNSKYL
DDATDVSEETVISEDAISLTLAKQQYAEELEAEMEDEFNRGLLISKQQYDQLRFEDEKIVALRNAKDIRELYQLAEEIIM
GENYVEAPEECEEEAVVEEPEQDISSDHEAQEPAKA
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0347190
2435
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0347188
1837
FBtr0347189
1083
FBtr0347187
2036
FBtr0475046
1604
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0312499
441
FBpp0312500
209
FBpp0312498
441
FBpp0423260
417
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG46025-PD
Name Synonyms
Secondary FlyBase IDs
    References (0)