Open Close
General Information
Symbol
Dmel\CG5316-PE
Species
D. melanogaster
Annotation Symbol
CG5316-PE
FlyBase ID
FBpp0401601
Associated gene
Length (aa)
443
Theoretical pI
10.21
Predicted MW (kDa)
51.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MEVDKLAYIRDELQRKLNDKRNFLIESDRAVVMKADYPKSQYHFRVVAKEEFRDITQLTEAQLPLLDHMMDLANQIIEKQ
KHLESRNFLIGFKVNTFWNRLNLHVISNDFYSMAMKRISHWNSFNTELFMPFQIAYMMLSVQGSIESISEETYNNLQEKT
PLRCNQCEFVTNMLLDLKAHLYQHWQRKEDERDQKKKVDKIIQMISETKLDEAEAKPKLLNEEEPIQAQPVAAIAQYPNE
HLGKPLTPQQQPGKQQAQNVYDKNINGPSVNMMNQNNPNNPFRNTPHLNRQSQKPPHPRSGPRGPMAPWTGPRFPCHQQQ
NRFRPPGFNACRQPYPPYHSGHQQFPNASSVGGGQTGLPGQGQGPRPKWNSNKIFNQQNRQNTVQAQPQAQNQQTNQQQI
QNSNKNQTPKKKPWKNRLQPVGKVQNQGGANRDPAPPSNSKPS
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0445726
2553
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0083759
2610
FBtr0083760
2483
FBtr0083758
2376
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0083173
139
FBpp0083174
662
FBpp0083172
662
External Crossreferences and Linkouts ( 2 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG5316-PE
Name Synonyms
Secondary FlyBase IDs
    References (0)