Open Close
General Information
Symbol
Dmel\CG4367-PC
Species
D. melanogaster
Annotation Symbol
CG4367-PC
FlyBase ID
FBpp0423078
Associated gene
Length (aa)
230
Theoretical pI
4.38
Predicted MW (kDa)
25.4
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MNTYKFILFLSMGFLNRMGELEGHGMMLSPTGRSSRWRYDNSAPTNYDDNALYCGGFWKQTENDGKCGLCGDDWSLEQPR
PNELGGKYGSGVIVKSFAGVDEAEINVKITANHLGYFRFHICDLDENGSESEDCFNQYPLNFTDGSQKYYINTTTGDIPV
TVKLPSDLNCIHCVLRWTYTAGNNWGVCEDGTGAMGCGAQETFINCADISVLSSARSIIQEVPVEVAESK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0473615
962
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0473616
839
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0423079
230
External Crossreferences and Linkouts ( 1 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG4367-PC
Name Synonyms
Secondary FlyBase IDs
    References (0)