Open Close
General Information
Symbol
Dmel\flw-PD
Species
D. melanogaster
Annotation Symbol
CG2096-PD
FlyBase ID
FBpp0423145
Associated gene
Length (aa)
339
Theoretical pI
6.25
Predicted MW (kDa)
38.8
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MGDFDLNVDSLIQRLLEMRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGF
PPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKTFTDCFNCLPV
AAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGVDVVSKFLNRHEL
DLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVDDTLMCSFQILKPSEKKAKYLYSGMNSSRPTTPQRS
APMLATNKKKXYIHPLPFP
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0474146
2131
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0071446
2524
FBtr0071447
2131
FBtr0333305
3883
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0071381
461
FBpp0071382
330
FBpp0305497
330
External Crossreferences and Linkouts ( 1 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
flw-PD
Name Synonyms
Secondary FlyBase IDs
    References (0)