Open Close
General Information
Symbol
Dmel\Sirt2-PC
Species
D. melanogaster
Annotation Symbol
CG5085-PC
FlyBase ID
FBpp0424325
Associated gene
Length (aa)
386
Theoretical pI
5.11
Predicted MW (kDa)
43.4
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MGDIEVKKEEQPTTPSNSSSSDDDEEAPDDTMDKVRRFFANTLHLGGSSDAKEEVKVEKVIPDLSFDGFAEHWRVHGFRK
IVTMVGAGISTSAGIPDFRSPGSGLYSNLKKYELPHPTAIFDLDYFEKNPAPFFALAKELYPGSFIPTPAHYFIRLLNDK
GLLQRHYTQNIDTLDRLTGLPEDKIIEAHGSFHTNHCIKCRKEYDMDWMKAEIFADRLPKCQKCQGVVKPDIVFFGENLP
KRFYSSPEEDFQDCDLLIIMGTSLEVQPFASLVWRPGPRCIRLLINRDAVGQASCVLFMDPNTRSLLFDKPNNTRDVAFL
GDCDAGVMALAKALGWDQELQQLITSERKKLSGSQNSEELQQGKEKPQSDPDKMTSGDRDKKDASL
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0479648
1399
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0479649
2285
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0424326
386
External Crossreferences and Linkouts ( 1 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
Sirt2-PC
Name Synonyms
Secondary FlyBase IDs
    References (0)