Open Close
Reference
Citation
Whitfield, E. (2000.5.15). FlyBase error report for CG18608 on Mon May 15 03:05:37 2000. 
FlyBase ID
FBrf0129073
Publication Type
Personal communication to FlyBase
Abstract
PubMed ID
PubMed Central ID
Text of Personal Communication
From FlyBase-error@XXXX Mon May 15  11:00:38  2000
Envelope-to: gm119@XXXX
Delivery-date: Mon, 15 May 2000  11:00:38  \+0100
From: FlyBase-error@XXXX
Date: Mon, 15 May 2000  03:05:37  \-0700 (PDT)
X-Authentication-Warning: hedgehog.lbl.gov: web set sender to FlyBase-error
using \-f
To: flybase-updates@XXXX
Cc: eleanor@XXXX
Subject: FlyBase error report for CG18608 on Mon May 15  03:05:37  2000
Content-Length: 2288
Error report from Eleanor Whitfield (eleanor@XXXX)
Gene or accession: CG18608
Gene annotation error
Gene CG18608 has a mistake in the supporting evidence or functional assignment.
Comments: prod has been sequenced by Celera as is shown to be gene CG15107
(AE003797; AAF57615).
I believe the correct annotation for prod is gene CG18608 (AE003797;
AAF57616) (the adjacent CDS on the same strand).
Full length prod has been sequenced by Torok et al, Genetics  135:71-80 
(1993) (sequence: U83596; AAC32727.1) and Itoh and Yu have sequenced
a C-terminal fragment (sequences AB018794; BAA76307 and AB022040;
BAA82621).
These sequences align 100% to CG18608.
Please update the annotation to correct the gene symbols
clustal of CG18608 to U83596; AAC32727.1
Q 1 MNRRNKRTSYYQYEVYLDFMEENPPMSANKLSRTQDGKKWKELSDLLNKCSTGPTLSPEE
MNRRNKRTSYYQYEVYLDFMEENPPMSANKLSRTQDGKKWKELSDLLNKCSTGPTLSPEE
T 1 MNRRNKRTSYYQYEVYLDFMEENPPMSANKLSRTQDGKKWKELSDLLNKCSTGPTLSPEE
Q 61 WRKRLNDWKNSTRSKYRRSINSDDKSNAMTPLENRALQIFSLEPNFREGISMRLHELMEE
WRKRLNDWKNSTRSKYRRSINSDDKSNAMTPLENRALQIFSLEPNFREGISMRLHELMEE
T 61 WRKRLNDWKNSTRSKYRRSINSDDKSNAMTPLENRALQIFSLEPNFREGISMRLHELMEE
Q 121 QEELDEEENENLEELVDEEEEEEVQYQQFIAEPHEQANPTIINGHSAAKKLRLDGSSEII
QEELDEEENENLEELVDEEEEEEVQYQQFIAEPHEQANPTIINGHSAAKKLRLDGSSEII
T 121 QEELDEEENENLEELVDEEEEEEVQYQQFIAEPHEQANPTIINGHSAAKKLRLDGSSEII
Q 181 YEVADVTSDQSAAKEPSAFYGEKIQEQLKRISDIHEASLHFKIARFKYNNPGFEYVPEL
YEVADVTSDQSAAKEPSAFYGEKIQEQLKRISDIHEASLHFKIARFKYNNPGFEYVPEL
T 181 YEVADVTSDQSAAKEPSAFYGEKIQEQLKRISDIHEASLHFKIARFKYNNPGFEYVPEL
clustal of CG18606 to CG15107
Q 1 MNRRNKRTSYYQYEVYLDFMEENPPMSANKLSRTQD----GKKWKELSDLLNKCSTGPTL
M+RR KRTS QY++Y+D ME \+P \+ \++ R D KKWKELSD LNKCS+GPTL
T 5 MDRRKKRTSSEQYQMYIDMMESDPIFATGRVPRDYDLNYLTKKWKELSDRLNKCSSGPTL
Q 57 SPEEWRKRLNDWKNSTRSKYRRSINSDDKSNAMTPLENRALQIFSLEPNFREGISMRLHE
\+PEEWRKRLNDWKN+TR KYRRS+ S \+K \+MT \+E RAL \+F P \+ L
T 65 TPEEWRKRLNDWKNTTRCKYRRSLLSTEKDISMTSVETRALDLFGKVPTTGGETMLNLKS
Q 117 LMEEQEELDEEENENLEELVDEEEEEEVQ
\+E \++ EE \+ \+E \+ V+
T 125 EKDEHDDEMEELGQRTSVAFQKELQAAVE
thanks
Browser: Mozilla/4.06 en (Win95; I)
Accessed from: query.pl, /www/hedgehog_8000/htdocs
DOI
Associated Information
Comments
Associated Files
Other Information
Secondary IDs
    Language of Publication
    English
    Additional Languages of Abstract
    Parent Publication
    Publication Type
    Abbreviation
    Title
    ISBN/ISSN
    Data From Reference
    Genes (2)