Reference Report
| Reference | |||
|---|---|---|---|
| Citation | Misra, S. (2000.7.28). Matches of the nc2 class to CGs. (Export to RIS) | ||
| FlyBase ID | FBrf0129567 | ||
| Publication Type | Personal communication to FlyBase | ||
| PubMed ID | |||
| PubMed Abstract | |||
| Text of Personal Communication |
Here are the matches of the nc2 class to CGs where possible, and to the
scaffolds, where there was not CG. cheers, sima> nc2: genes with no SWP but with either TREMBL or PIR (47). Quite a > few of these have a PIR entry and no nucleic acid one -- no idea > what that means. Again some of these (commented) have already been > looked at. > X-Sun-Data-Name: nc2 > Acp98AB - Cat 1 residue =new exon in first intron of CG12879 CT32023 FBan0012879 FBgn0039540>gb|AE003762.1|AE003762 Drosophila melanogaster genomic scaffold 142000013386035 section 87 of 105, complete sequence Length = 230995 Score = 52.3 bits (123), Expect = 2e-07 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +2 Query: 2 EFPNPVLSRIGRSLRTNKGTHYQRMT 27 E NPVLSRIGRSLRTNKGTHYQRMT Sbjct: 33911 EVTNPVLSRIGRSLRTNKGTHYQRMT 33988 Database: Drosophila Genome Posted date: Apr 10, 2000 4:44 PM Number of letters in database: 122,680,987 Number of sequences in database: 1181> Acph-1 (438aa) =CG7899|FBan0007899|CT6619|FBan0007899 last_updated:000321 (438aa) 95% id over 438aa> anon-63BC-T3 O18384(31aa) by BLASTP against predicted proteins at BDGP =CG14965|FBan0014965|CT34811|FBan0014965 last_updated:000321(537aa) Score = 65 (22.9 bits), Expect = 0.049, P = 0.048 Identities = 11/11 (100%), Positives = 11/11 (100%) Query: 21 MHFFKFPVKDP 31 MHFFKFPVKDP Sbjct: 1 MHFFKFPVKDP 11 missing first 20aa in CG> anon-67Ea - Cat 9 residue, BLASTN finds CGless seq CAA48385(170aa) by BLASTP against predicted proteins at BDGP =no protein in GadFly GenBank:X68309(2578bp) by BLASTN against all at BDGP =gb|AE003547|Drosophila melanogaster genomic scaffold, 142000013386050 section 34 of 54, complete sequence very approximately (need sim4 alignment) ~1987-900 = 254926-256070, 163-865 = 256739-256036, 2568-1973 = 254288-254883, 164-68 = 256797-256893, 71-1 = 257060-257130 > Crlbp S65395(11aa) by Pattern Search against predicted proteins at BDGP =FBan0001668=CG1668|FBan0012467|CT4586=Pbprp2=FBgn0011280 > ect A61047(280aa) by BLASTP against predicted proteins at BDGP =CG11965|FBan0011965|CT37129|FBan0011965 last_updated:000321(429aa) Score = 168 (59.1 bits), Expect = 5.1e-19, Sum P(2) = 5.1e-19 Identities = 38/50 (76%), Positives = 38/50 (76%) Query: 1 MKFVIXXXXXXXXXXQIEASPLQRLSRSERAVSPQQTVNNEVAPAVRPAS 50 MKFVI QIEASPLQRLSRSERAVS QQTVNNEVAPAV PAS Sbjct: 1 MKFVILLCVLSALLLQIEASPLQRLSRSERAVSRQQTVNNEVAPAVAPAS 50 Score = 75 (26.4 bits), Expect = 5.1e-19, Sum P(2) = 5.1e-19 Identities = 17/41 (41%), Positives = 17/41 (41%) Query: 155 LDEXXXXXXXXXXXGISDGVDLPAESXXXXXXXXXXXXXDE 195 LDE GISDGVDLPAES DE Sbjct: 155 LDEVAPAAASSVSAGISDGVDLPAESGNAAEVLAAGNAADE 195 > EG:34F3.2 - part of CG12467 O77432(504aa) by BLASTP against predicted proteins at BDGP =CG12467|FBan0012467|CT32681|FBan0012467 last_updated:000321(1376aa) 77-524 of CG12467 corresponds to 38-485 of EG:34F3.2 40-47 of ' 1-8 '> Gprk3 C41615(55aa) by BLASTP against predicted proteins at BDGP =CG8224|FBan0008224|CT8241|FBan0008224 last_updated:000321(601aa) Score = 268 (94.3 bits), Expect = 8.0e-24, P = 8.0e-24 Identities = 51/55 (92%), Positives = 54/55 (98%) Query: 1 VVYRDLKSKNILVKSNLSCAIGDLGLAVRHVEKNDSVDIPSTHRVGTKRYMAPEI 55 + +RDLKSKNILVKSNLSCAIGDLGLAVRHVEKNDSVDIPSTHRVGTKRYMAPE+ Sbjct: 427 IAHRDLKSKNILVKSNLSCAIGDLGLAVRHVEKNDSVDIPSTHRVGTKRYMAPEV 481> Gprk4 D41615(49aa) by BLASTP against predicted proteins at BDGP =CG3051|FBan0003051|CT10258|FBan0003051 last_updated:000321(582aa) Score = 222 (78.1 bits), Expect = 7.1e-19, P = 7.1e-19 Identities = 43/50 (86%), Positives = 46/50 (92%) Query: 1 VVYRDLKPKNLLLDHNMHAKIADFGLSNMMLDGEFLRTSA-SPNYMAPEV 49 +V+RDLKP+NLLLDHNMH KIADFGLSNMMLDGEFLRTS SPNY APEV Sbjct: 147 IVHRDLKPENLLLDHNMHVKIADFGLSNMMLDGEFLRTSCGSPNYAAPEV 196> GstD21 D46681(214aa) by BLASTP against predicted proteins at BDGP =CG4181|FBan0004181|CT13804|FBan0004181 last_updated:000321(215aa) 214/214 (100%) id> GstD23 E46681(214aa) by BLASTP against predicted proteins at BDGP =CG11512|FBan0011512|CT36385|FBan0011512 last_updated:000321(215aa) 213/214 (99%) id> GstD24 C46681(215aa) by BLASTP against predicted proteins at BDGP =CG12242|FBan0012242|CT13898|FBan0012242 last_updated:000321(210aa) 209/215 (97%) id (gap of 6aa in subject)> GstD25 B46681(214aa) by BLASTP against predicted proteins at BDGP =CG4423|FBan0004423|CT13946|FBan0004423 last_updated:000321(215aa) 214/214 (100%) id> GstD26 H46681(170aa) by BLASTP against predicted proteins at BDGP =CG4371|FBan0004371|CT13952|FBan0004371 last_updated:000321(224aa) 170/170 (100%) id> GstD27 JQ1378(212aa) by BLASTP against predicted proteins at BDGP =CG4421|FBan0004421|CT13954|FBan0004421 last_updated:000321(212aa) 211/212 (99%) id> Gta D46036(150aa) by BLASTP against predicted proteins at BDGP =CG4268|FBan0004268|CT13850|FBan0004268 last_updated:000321(952aa) Score = 705 (248.2 bits), Expect = 5.5e-71, P = 5.5e-71 Identities = 147/152 (96%), Positives = 147/152 (96%) Query: 1 VVYRAKDKRTNEIEALKRLKMEKEKEGFPITSRREINTLLKGGQHPNIVTVREIVVGSNM 60 VVYRAKDKRTNEI ALKRLKMEKEKEGFPITS REINTLLKG QHPNIVTVREIVVGSNM Sbjct: 571 VVYRAKDKRTNEIVALKRLKMEKEKEGFPITSLREINTLLKG-QHPNIVTVREIVVGSNM 629 Query: 61 DKIFIVMDYVEHDLKSLMETMKNRKQSFFPGEVKCLTQQL-RAVAHLHDN-ILHRDLKTS 118 DKIFIVMDYVEHDLKSLMETMKNRKQSFFPGEVKCLTQQL RAVAHLHDN ILHRDLKTS Sbjct: 630 DKIFIVMDYVEHDLKSLMETMKNRKQSFFPGEVKCLTQQLLRAVAHLHDNWILHRDLKTS 689 Query: 119 NLLLSHKGILKVGDFGLAREYGSPIKK-TSLVV 150 NLLLSHKGILKVGDFGLAREYGSPIKK TSLVV Sbjct: 690 NLLLSHKGILKVGDFGLAREYGSPIKKYTSLVV 722> Hmx Q24016(34aa) by BLASTP against predicted proteins at BDGP =CG5832|FBan0005832|CT18293|FBan0005832 last_updated:000321(263aa) Score = 169 (59.5 bits), Expect = 3.5e-14, P = 3.5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Query: 1 FDLKRYLSSSERAGLAASLRLTETQVKIWFQNRR 34 FDLKRYLSSSERAGLAASLRLTETQVKIWFQNRR Sbjct: 158 FDLKRYLSSSERAGLAASLRLTETQVKIWFQNRR 191> Hrb85CD - probably same gene as Hrb87F Q24486(386aa) by BLASTP against predicted proteins at BDGP =CG12749|FBan0012749|CT27250|FBan0012749 last_updated:000321(385aa) 198/198 (100%) id> ImpE3 A61046(331aa) by BLASTP against predicted proteins at BDGP =CG2723|FBan0002723|CT9257|FBan0002723 last_updated:000321(325aa) 188/191 (98%) id> l(2)rot - Cat 2 residue, BLASTN finds CGless seq S42089(542aa) by BLASTP against predicted proteins at BDGP =no proteins in GadFly X95246(2818bp) by BLASTN against all at BDGP =overlaps on opposite strand CG5504 CG5504|FBan0005504|CT17450|FBan0005504 last_updated:000321(1635bp) very approximately (need sim4 alignment) ~2632-1240, 1100-843 = 1-1365, 1378-1635bp of CG =gadfly|SEG:AE003461|gb|AE003461|Drosophila melanogaster genomic scaffold 142000013386038 section 10 of 15, complete sequence. 2818-1 = 228045-230862 of scaffold> l(3)73Ah PIR:JC4296(222aa) by BLASTP against predicted proteins at BDGP =CG4195|FBan0004195|CT13794|FBan0004195 last_updated:000321(222aa) 221/222 (99%) id> Lcp6 - Cat 1 residue, BLASTN finds CGless seq SPTREMBL:P92184(104aa) by BLASTP against predicted proteins at BDGP =no proteins in GadFly U84756(473bp) by BLASTN against all at BDGP =gb|AE003563|Drosophila melanogaster genomic scaffold 142000013386050 section 50 of 54, complete sequence. very approximately (need sim4 alignment) 330-13 = 242870-243193, poor but 462-334 = 27439-27567> Lcp65Ab1 - Cat 2 residue, BLASTN finds CGless seq SPTREMBL:P92192(104aa) by BLASTP against predicted proteins at BDGP =no proteins in GadFly U84747(947bp) by BLASTN against all at BDGP =gb|AE003563|Drosophila melanogaster genomic scaffold 142000013386050 section 50 of 54, complete sequence. very approximately (need sim4 alignment) 946-1 = 242514-243462> Lcp65Ab2 - Cat 2 residue, BLASTN finds CGless seq SPTREMBL:P92192(104aa) by BLASTP against predicted proteins at BDGP =no proteins in GadFly U84746(855bp) by BLASTN against all at BDGP =gb|AE003563|Drosophila melanogaster genomic scaffold 142000013386050 section 50 of 54, complete sequence. very approximately (need sim4 alignment) 855-1 = 245477-246316> Mat89Ba SPTREMBL:Q27924(545aa) by BLASTP against predicted proteins at BDGP =CG6814|FBan0006814|CT21143|FBan0006814 last_updated:000321(689aa) CG has extra 27aa at N-term, a few polymorphisms> Mst40 - possibly untranslated? (Aubrey Apr 4) SPTREMBL:Q24437(23aa) by BLASTP against predicted proteins at BDGP =no proteins in GadFly Z22588(1387bp) by BLASTN against all at BDGP =gb|AE003466|Drosophila melanogaster genomic scaffold 142000013386038 section 15 of 15, complete sequence. very approximately (need sim4 alignment) 1-1387 = 161926-163314 1-799 = 163309-164114, ~800-1387 = 164130-164722 (two closely related genes near each other)> NaCP37B - Cat 1 residue SPTREMBL:Q24308(113aa) by BLASTP against predicted proteins at BDGP =no proteins in GadFly X84408(384bp) by BLASTN against all at BDGP =CG9071|FBan0009071|CT24831|FBan0009071 last_updated:000321(7375bp) very approximately (need sim4 alignment) 1-240 = 6438-6677 of CG, 241-377 = 6700-6823 of CG > ph-d PIR:S23632(1589aa) by BLASTP against predicted proteins at BDGP =CG3895|FBan0003895|CT12875|FBan0003895 last_updated:000321(1211aa) from 130-594 of CG3895, CG missing exon, then a few other polymorphisms till end of CG, then =CG18414|FBan0018414|CT41888|FBan0018414 last_updated:000321(290aa) from 1300 to 1589 of S23632 for all of CG> Pk1 SPTREMBL:Q24057(36aa) by BLASTP against predicted proteins at BDGP =no proteins in GadFly U23827(110bp) by BLASTN against all at BDGP =gb|AE002760|Drosophila melanogaster genomic scaffold 142000013386034, complete sequence. 1-110 = 24362-24471>PpD19 SPTREMBL:Q26247(24aa) by BLASTP against predicted proteins at BDGP =CG10930|FBan0010930|CT30615|FBan0010930 last_updated:000321(314aa) 24/24 (100%) id> PpD3 PIR:AAB22463(25aa) by BLASTP against predicted proteins at BDGP =CG8402|FBan0008402|CT24679|FBan0008402 last_updated:000321 25/25 (100%) id> PpD33 PIR:AAB22469(24aa) by BLASTP against predicted proteins at BDGP =CG9842|FBan0009842|CT27780|FBan0009842 last_updated:000321(570aa) 24/24 (100%) id> PpD5 PIR:AAB22464(24aa) by BLASTP against predicted proteins at BDGP =CG10138|FBan0010138|CT10817|FBan0010138 last_updated:000321(346aa) 24/24 (100%) id> PpD6 PIR:AAB22465 (24aa) by BLASTP against predicted proteins at BDGP =CG8822|FBan0008822|CT25390|FBan0008822 last_updated:000321(336aa) 24/24 (100%) id>prd3 PIR:AAA28839(38aa) by BLASTP against predicted proteins at BDGP =no protein in GadFly M14551(114bp) by BLASTN against all at BDGP =CG10037|FBan0010037|CT28091|FBan0010037 last_updated:000321(2556bp) 1-114 = 2122-2235> Rbp10 PIR:I48110(44aa) by BLASTP against predicted proteins at BDGP =CG3151|FBan0003151|CT38165|FBan0003151 last_updated:000321(68aa) =CG3151|FBan0003151|CT10570|FBan0003151 last_updated:000321(673aa) 43/43 (100%) id, 114-156 of CG > Rbp11 PIR:A47752(39aa) by BLASTP against predicted proteins at BDGP =no protein in GadFly closest match: CG17136|FBan0017136|CT38058|FBan0017136 last_updated:000321 Length = 135 Score = 152 (53.5 bits), Expect = 2.2e-12, P = 2.2e-12 Identities = 29/39 (74%), Positives = 30/39 (76%) Query: 1 FVGNLAPRRSKPRDRSAFAKYGPLRNVWVARNPPGFAFV 39 +VGNL SK AFAKYGPLRNVWVARNPPGFAFV Sbjct: 14 YVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFAFV 52 S51740(117bp) by BLASTN agianst all at BDGP =CG17136|FBan0017136|CT38058|FBan0017136 last_updated:000321(511bp) Plus Strand HSPs: Score = 490 (73.5 bits), Expect = 2.3e-16, P = 2.3e-16 Identities = 110/117 (94%), Positives = 110/117 (94%), Strand = Plus / Plus Query: 1 TTCGTGGGGAACCTGG-CTCCTCGGCGCTCCAAGCCACGAGATAGAAG-CGCATTTGCCA 58 T CGTGGG AACCTGG CTCCTCGGCG TCCAAGC ACGAGATAGAAG CGCATTTGCCA Sbjct: 93 TACGTGGGAAACCTGGGCTCCTCGGCG-TCCAAGC-ACGAGATAGAAGGCGCATTTGCCA 150 Query: 59 AATATGGACCCCTGCGAAACGTGTGGGTGGCCCGCAATCCACCAGGGTTCGCTTTCGTC 117 AATATGGACCCCTGCGAAACGTGTGGGTGGCCCGCAATCCACCAGG TTCGC TT GTC Sbjct: 151 AATATGGACCCCTGCGAAACGTGTGGGTGGCCCGCAATCCACCAGGTTTCGCCTTTGTC 209> Rbp12 PIR:B47752(41aa) by BLASTP against predicted proteins at BDGP =CG5422|FBan0005422|CT17178|FBan0005422 last_updated:000321(464aa) =CG5422|FBan0005422|CT17194|FBan0005422 last_updated:000321(464aa) 39/41 (95%) id > Rbp2 PIR:B48110(43aa) by BLASTP against predicted proteins at BDGP =CG4429|FBan0004429|CT14414|FBan0004429 last_updated:000321(325aa) 40/43 (93%) id, 32-74 of CG> Rbp3 PIR:C48110(44aa) by BLASTP against predicted proteins at BDGP =CG17791|FBan0017791|CT39414|FBan0017791 last_updated:000321(378aa) 31/32 (96%) id, 149-180 of CG> Rbp5 PIR:E48110(48aa) by BLASTP against predicted proteins at BDGP =no protein in GadFly S51706(144bp) by BLASTN against all at BDGP overlaps opposite strand of CG3373|FBan0003373|CT11347|FBan0003373 last_updated:000321(2291bp) Minus Strand HSPs: Score = 635 (95.3 bits), Expect = 2.6e-22, P = 2.6e-22 Identities = 135/141 (95%), Positives = 135/141 (95%), Strand = Minus / Plus Query: 143 ACGAAACCGAA-CCCACTACCAAGACGACAACTACTACAACCACGCCAAAGCCCACTACC 85 AC A CCGAA CCCACTACCAAGACGACAACTACTACAACCACGCCAAAGCCCACTACC Sbjct: 1470 ACCACGCCGAAACCCACTACCAAGACGACAACTACTACAACCACGCCAAAGCCCACTACC 1529 Query: 84 ACAACGACAACCAAGAAGCCAACGACCACTACCACCACTACGACAACCACGCCGAAGCCA 25 ACAACGACAACCAAGAAGCCAACGACCACTACCACCACTACGACAACCACGCCGAAGCCA Sbjct: 1530 ACAACGACAACCAAGAAGCCAACGACCACTACCACCACTACGACAACCACGCCGAAGCCA 1589 Query: 24 ACAACTACTTAGTCCGCCAACA 3 ACAACTACT AG CCGCC ACA Sbjct: 1590 ACAACTACTAAG-CCGCCGACA 1610> Rbp6 PIR:F48110(44aa) by BLASTP against predicted proteins at BDGP =no protein in GadFly S51715(132bp) by BLASTN against all at BDGP =gb|AE003524|Drosophila melanogaster genomic scaffold 142000013386050 section 11 of 54, complete sequence. Plus Strand HSPs: Score = 430 (64.5 bits), Expect = 9.1e-13, P = 9.1e-13 Identities = 90/95 (94%), Positives = 90/95 (94%), Strand = Plus / Plus Query: 30 TCCAGAGAGCTTACGCGATTACTTCGGACGTTACGGTGATATCTCAGAGGCTATGGTCAT 89 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 314913 TTCAGAGAGCTTACGCGATTACTTCGGACGTTACGGTGATATCTCAGAGGCTATGGTCAT 314972 Query: 90 GAAGGATCCCACGACGCGCAGATCCAGAGGTTTTG 124 ||||||||||||||||||||||||||| | ||| Sbjct: 314973 GAAGGATCCCACGACGCGCAGATCCAGGTGAGTTG 315007 > Rbp7 PIR:G48110(44aa) by BLASTP against predicted proteins at BDGP =CG10377|FBan0010377|CT29098|FBan0010377 last_updated:000321(421aa) 44/44 (100%) id, 10-53 of CG> Rbp8 PIR:H48110(36aa) by BLASTP against predicted proteins at BDGP =CG10851|FBan0010851|CT41998|FBan0010851 last_updated:000321(132aa) =CG10851|FBan0010851|CT30371|FBan0010851 last_updated:000321(329aa) 31/36 (86%) id> repo - part of CG8045 PIR:A54282(612aa) by BLASTP against predicted proteins at BDGP =CG8045|FBan0008045|CT24072|FBan0008045 last_updated:000321(612aa) > Rya-r76CD - misassigned to CG10844 PIR:B49131(508aa) by BLASTP against predicted proteins at BDGP =CG10844|FBan0010844|CT30357|FBan0010844 last_updated:000321(5107aa) C terminal 4599-5107aa of CG Z18536(1528bp) by BLASTN against all at BDGP =CG10844|FBan0010844|CT30357|FBan0010844 last_updated:000321(15606bp) 1-1528 = 13794-15325 |
||
| DOI | |||
| Related Publication(s) | |||
Recent Updates
|
|||
| Description |
What does this section display?
This section contains items that were added to this record for each release.
It currently only tracks new links between this FlyBase report and other
FlyBase data classes (e.g. genes, references, stocks) or controlled
vocabulary terms (e.g. GO, anatomy terms).
What does this section not display?
This section does not currently display links that were removed or gene model changes.
|
||
| Update Feed |
Click the icon below to subscribe to this FlyBase record and receive updates automatically through your
feed reader.
|
||
| FB2013_03 | |||
| FB2013_02 | |||
| All updates | Click here to see a list of all updates to this record from FB2010_08 and on. | ||
Associated Information
|
|||
| Comments | |||
| Associated Files | |||
Other Information
|
|||
| Secondary IDs | |||
| Language of Publication | English | ||
| Additional Languages of Abstract | |||
| Also Published As | |||
Parent Publication
|
|||
| Publication Type | |||
| Abbreviation | |||
| Title | |||
| ISBN/ISSN | |||
Data from Reference
|
|||
Genes (20)
|
|||
Recent Updates