Home
Reference Report
| Reference | |||
|---|---|---|---|
| Citation | Theopold, U. (2000.7.21). Lectins from FBrf0110927. (Export to RIS) | ||
| FlyBase ID | FBrf0131107 | ||
| Publication Type | Personal communication to FlyBase | ||
| PubMed ID | |||
| PubMed Abstract | |||
| Text of Personal Communication |
From leyla@XXXXXXXXXXXXXXX Fri Aug 25 16:31:56 2000
Envelope-to: gm119@XXXXXXXXXXXXXXX Delivery-date: Fri, 25 Aug 2000 16:31:56 \+0100 Date: Fri, 25 Aug 2000 11:38:11 \-0400 (EDT) From: Leyla Bayraktaroglu <leyla@XXXXXXXXXXXXXXX> Reply-To: Leyla Bayraktaroglu <leyla@XXXXXXXXXXXXXXX> Subject: Personal communication from Uli Theopold To: cambridge-curators@XXXXXXXXXXXXXXX Cc: leyla@XXXXXXXXXXXXXXX MIME-Version: 1.0 Content-Type: MULTIPART/mixed; BOUNDARY='Cete_of_Badgers_541_000' X-Mailer: dtmail 1.2.1 CDE Version 1.2.1 SunOS 5.6 sun4u sparc Content-Length: 37838 Dear Cambridge Curators, Attached (and also included in the body of this email) is a personal communication from Uli Theopold from Mon, 21 Aug 2000, correlating the lectins from FBrf0110927 with the Celera predicted genes. Theopold, U., Rissler, M., Fabbri, M., Schmidt, O., Natori, S. Insect glycobiology: a lectin multigene family in Drosophila melanogaster. Biochem. biophys. Res. Commun. 1999 261(3):923--927 _____________________________________________________________________ lectin-24Da AC004279a N/A lectin-24Db AC004371a CG2958 lectin-24Fa AC004373a N/A lectin-24Fb AC004373b N/A lectin-29Ca AC004423a CG17799 accessory gland protein AC004423b CG17797 lectin-21Ca AC004573a CG2826 lectin-21Cb AC004573b CG13686 lectin-22C AC004716a CG15378 lectin-28C AC004723a CG7106 lectin-24A AC005149a CG3410 lectin-30A AC005889a CG17011 lectin-galC1 AC007082a CG9976 lectin-37Da AC007082b CG9978 lectin-37Db AC007082c CG9978 lectin-33A AC007083a CG16834 lectin-44Ca AC007330a CG1656 lectin-46Cb AC007330b CG1652 CK02422a CG7763 Incilarin-like GH10831 CG8343 N/A: not annotated AC004279a: in genomic clone AE 003578: around positions 44000-43000 AC004373a: in genomic clone AE 003576: around positions 205000-204000 AC004373b: in genomic clone AE003576: around positions 175000-174000 _____________________________________________________________________ Mime-Version: 1.0 X-Sender: uli@XXXXXXXXXXXXXXX Date: Fri, 1 Sep 2000 10:31:01 \+0200 To: Leyla Bayraktaroglu <leyla@XXXXXXXXXXXXXXX> From: Uli Theopold <uli@XXXXXXXXXXXXXXX> Subject: Re: Lectins Dear Leyla, I realised there was a problem and looked into the region between our two predicted lectins (37Da and 37Db), which had been put together into one lectin with two domains during the annotation. I think a small exon was missed, which adds a potential signal peptide to the lectin 37Db (between pos. 240829-241039 in clone AE003662). This exon is predicted by Genie (96 version, which I used from BDGP from Nomi Harris) but seems to have been missed by the later version. I experienced similar problems with lectin 38Da before but the signal peptide there seems ok. The predicted sequence after in silico slicing for the lectin 37Db would be: MVKLLLLFLVCWSALPLESSPLGNRYNLEIGEKQYYISLAKTNWFEASNHCRQNGGFLLN LESREELELLSPHLHPAYSYWLSINDLGERGVYVSEATGLEAPFLNWSAGEPDNSSGYDR CVELWLSTTSFQMNDLPCYSSVAFICQLN The lectin 37Db would correspond to the aminoterminal half of CG9978, maybe a bit longer since the first stop codon is downstream of the splice site used in the annotation: MLKTLVQLFLVVAGFAPGFGYDKYTTHIQNGNPYNLTVDMTPFIKINESY YVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHW TSGNDLGKTGTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYS TEFQLNDRPCHNHASSLFKYICEAPKQETVSIVVWEK Hope I could help you Uli Ulrich Theopold, PhD Dept. of Molecular Biology ph.: \+46-8-16 41 81 Stockholm University fax: \+46-8-15 23 50 S-106 91 Stockholm, Sweden e-mail: uli@XXXXXXXXXXXXXXX |
||
| DOI | |||
| Related Publication(s) | |||
Recent Updates
|
|||
| Description |
What does this section display?
This section contains items that were added to this record for each release.
It currently only tracks new links between this FlyBase report and other
FlyBase data classes (e.g. genes, references, stocks) or controlled
vocabulary terms (e.g. GO, anatomy terms).
What does this section not display?
This section does not currently display links that were removed or gene model changes.
|
||
| Update Feed |
Click the icon below to subscribe to this FlyBase record and receive updates automatically through your
feed reader.
|
||
| FB2013_03 | |||
| FB2013_02 | |||
| All updates | Click here to see a list of all updates to this record from FB2010_08 and on. | ||
|
Associated Information
|
|||
| Comments | |||
| Associated Files | |||
|
Other Information
|
|||
| Secondary IDs | |||
| Language of Publication | English | ||
| Additional Languages of Abstract | |||
| Also Published As | |||
|
Parent Publication
|
|||
| Publication Type | |||
| Abbreviation | |||
| Title | |||
| ISBN/ISSN | |||
|
Data from Reference
|
|||
| Genes (20)
|
|||