Open Close
Reference
Citation
Ashburner, M. (2000.10.30). FlyBase error report on Mon Oct 30 11:01:07 2000. 
FlyBase ID
FBrf0131207
Publication Type
Personal communication to FlyBase
Abstract
PubMed ID
PubMed Central ID
Text of Personal Communication
From ma11 Mon Oct 30  09:43:18  2000
To: ma11XXXX, ag24XXXX
Subject: FlyBase sequence errors for Heat shock Proteins 70
X-Sun-Charset: US-ASCII
Content-Length: 1008
X-Lines: 33
Aubrey pointed this out. I replied that I was by no means surprised since
the assembly algorithm is really unhappy with low copy-number repeats
as are at both Hsp70A and Hsp70B.
But I did a leetle investigation of v1.0 proteins:
These are probably bits of Hsp70B (at 87C):
>CG6489|FBan0006489|CT20131|FBan0006489  last_updated:000321 
EKHRQRIPSRNALESYVFNVKQSVEQAPAGKLDEADKNSVLDKCNETIRWLDSNTTAEKE
EFDHKMEELTRHCSPIMTKMHQQGAGAAGGPGANCGQQAGGFGGYSGPTVEEVD
>CG5834|FBan0005834|CT18301|FBan0005834  last_updated:000321 
MHQQGAGAAGGPGANCGQQAGGFGGYSGPTVEEITDYKMEPPFAPLSESCTKALGDKVYE
KRKLASQEIRHPNWEM
Michael
DOI
Associated Information
Comments
Associated Files
Other Information
Secondary IDs
    Language of Publication
    English
    Additional Languages of Abstract
    Parent Publication
    Publication Type
    Abbreviation
    Title
    ISBN/ISSN
    Data From Reference
    Genes (4)