Home
Reference Report
| Reference | |||
|---|---|---|---|
| Citation | Davis, T. (2001.5.1). FlyBase error report for CG14307 on Tue May 1 03:43:32 2001. (Export to RIS) | ||
| FlyBase ID | FBrf0136019 | ||
| Publication Type | Personal communication to FlyBase | ||
| PubMed ID | |||
| PubMed Abstract | |||
| Text of Personal Communication |
From FlyBase-error@XXXXXXXXXXXXXXX Tue May 01 11:44:04 2001
Envelope-to: gm119@XXXXXXXXXXXXXXX Delivery-date: Tue, 1 May 2001 11:44:04 \+0100 From: FlyBase-error@XXXXXXXXXXXXXXX Date: Tue, 1 May 2001 03:43:32 \-0700 (PDT) X-Authentication-Warning: hedgehog.lbl.gov: web set sender to FlyBase-error using \-f To: flybase-updates@XXXXXXXXXXXXXXX Cc: davist2@XXXXXXXXXXXXXXX Subject: FlyBase error report for CG14307 on Tue May 1 03:43:32 2001 Content-Length: 1960 Error report from Terence Davis (davist2@XXXXXXXXXXXXXXX) Gene or accession: CG14307 Release: 1 Gene annotation error Gene CG14307 has incorrect exon/intron structure or translation start site. Comments: I have an annotation correction for gene CG14307. This gene is part of the fruitless locus (FlyBase ID FBgn0004652) and is a single exon. This is an alternative splice form of the fru gene called fru type E (see Usui-Aoki K, Ito H, Ui-Tei K, Takahashi K, Lukacsovich T, Awano W, Nakata H, Piao ZF, Nilsson EE, Tomida J, Yamamoto D. Formation of the male-specific muscle in female Drosophila by ectopic fruitless expression. Nat Cell Biol. 2000 Aug;2(8):500-6.). With reference to the genomic sequence AE003722 this exon is: 37789..37245 stop codon at 37243..37245 and splices from 45381 (these are complementary strand of AE003722). The peptide sequence is below: this starts at nucleotide 37787 (37789-37788 are second and third bases of previous codon) SKAWHMRLTFERLSGGCNLHRCKLCGKVVTHIRNHYHVHFPGRFECPLCRATYTRSDNLRTHCKFKHPMYNPDTRKFDN LMSSSAVGAAATPTASQLAVASQAAMAAAAAAAFNAAQQQQQQQQQQQQHQHQQQQQHQQSQQQQQQQQQSQQQLHALA QQHMLQLQPQHHQQQQHNATSE Please note that the above peptide is longer than that from the given reference and is a comparison from the type e protein in D. heteroneura. I believe as the genomic sequence between melanogaster (AE003722) and heteroneura (AF051664) are so similar that a mistake has been made with the cDNA in the reference. There is also a type d protein: This is an extension of one of the exons in CG7689 Thus 45513..45373 (instead of 45513..45381) Stop codon 453375..45373 This truncates the fru protein and it ends with aa VE (see above ref) To summarise the various fru alternative 3' forms: Type A: gene CG7689 Type B: gene CG7688 Type C: (see FBrf0129326) Type D: (above) Type E: gene CG14307 |
||
| DOI | |||
| Related Publication(s) | |||
Recent Updates
|
|||
| Description |
What does this section display?
This section contains items that were added to this record for each release.
It currently only tracks new links between this FlyBase report and other
FlyBase data classes (e.g. genes, references, stocks) or controlled
vocabulary terms (e.g. GO, anatomy terms).
What does this section not display?
This section does not currently display links that were removed or gene model changes.
|
||
| Update Feed |
Click the icon below to subscribe to this FlyBase record and receive updates automatically through your
feed reader.
|
||
| FB2013_03 | |||
| FB2013_02 | |||
| All updates | Click here to see a list of all updates to this record from FB2010_08 and on. | ||
|
Associated Information
|
|||
| Comments | |||
| Associated Files | |||
|
Other Information
|
|||
| Secondary IDs | |||
| Language of Publication | English | ||
| Additional Languages of Abstract | |||
| Also Published As | |||
|
Parent Publication
|
|||
| Publication Type | |||
| Abbreviation | |||
| Title | |||
| ISBN/ISSN | |||
|
Data from Reference
|
|||
| Genes (2)
|
|||