Open Close
Reference
Citation
Nelson, D. (2001.2.5). Drosophila melanogaster P450 protein sequences. 
FlyBase ID
FBrf0136021
Publication Type
Personal communication to FlyBase
Abstract
PubMed ID
PubMed Central ID
Text of Personal Communication
[FlyBase curator comment: sequence of Drosophila melanogaster P450
protein sequences, taken from web page
http://drnelson.utmem.edu/droso.all.P450s.html on 5.2.2001.]
>4C3 AC014779 73845-80196 also AC008219
MSSKVITSLMAESILLSKVGQVISGYSPITVFLLGSILIFLVVYNKRRSRLVKYIEKIPG
PAAMPFLGNAIEMNVDHDELFNRVIGMQKLWGTRIGINRVWQGTAPRVLLFEPETVEPIL
NSQKFVNKSHDYDYLHPWLGEGLLTSTDRKWHSRRKILTPAFHFKILDDFIDVFNEQSAV
LARKLAVEVGSEAFNLFPYVTLCTLDIVCETAMGRRIYAQSNSESEYVKAVYGIGSIVQS
RQAKIWLQSDFIFSLTAEYKLHQSYINTLHGFSNMVIRERKAELAILQENNNNNNNNAPD
AYDDVGKKKRLAFLDLLIDASKEGTVLSNEDIREEVDTFMFEGHDTTSAAISWTLFLLGC
HPEYQERVVEELDSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDV
NIGGKIVPAGTQAIIMTYALHRNPRVFPKPEQFNPDNFLPENCAGRHPFAYIPFSAGPRN
CIGQKFAILEEKAVISTVLRKYKIEAVDRREDLTLLGELILRPKDGLRVKITPRD
>4d1 AC017770 49988-51720
MFLVIGAILASALFVGLLLYHLKFKRLIDLISYMPGPPVLPLVGHGHHFIGKPPHEMVKK
IFEFMETYSKDQVLKVWLGPELNVLMGNPKDVEVVLGTLRFNDKAGEYKALEPWLKEGLL
VSRGRKWHKRRKIITPAFHFKILDQFVEVFEKGSRDLLRNMEQDRLKHGDSGFSLYDWIN
LCTMDTICETAMGVSINAQSNADSEYVQAVKTISMVLHKRMFNILYRFDLTYMLTPLARA
EKKALNVLHQFTEKIIVQRREELIREGSSQESSNDDADVGAKRKMAFLDILLQSTVDERP
LSNLDIREEVDTFMFEGHDTTSSALMFFFYNIATHPEAQKKCFEEIRSVVGNDKSTPVSY
ELLNQLHYVDLCVKETLRMYPSVPLLGRKVLEDCEINGKLIPAGTNIGISPLYLGRREEL
FSEPNIFKPERFDVVTTAEKLNPYAYIPFSAGPRNCIGQKFAMLEIKAIVANVLRHYEVD
FVGDSSEPPVLIAELILRTKEPLMFKVRERVY
>4d1 alt. splice AC017770 48817-51720
MWLLLSLVLLLAIIALEMRRFLRNMRTIPGPLPLPLLGNAHIFLGLTPAEACLKIGELAE
RHGDTFGLFLGPSYSVMLFNPRDVERVLGSSQLLTKSQEYSFLGRWLNEGLLVSNGRKWH
RRRKIITPAFHFRILEPYVEIFDRQSLRLVEELALRISRGQERINLGEAIHLCALDAICE
TAMGVSINAQSNADSEYVQAVKTISMVLHKRMFNILYRFDLTYMLTPLARAEKKALNVLH
QFTEKIIVQRREELIREGSSQESSNDDADVGAKRKMAFLDILLQSTVDERPLSNLDIREE
VDTFMFEGHDTTSSALMFFFYNIATHPEAQKKCFEEIRSVVGNDKSTPVSYELLNQLHYV
DLCVKETLRMYPSVPLLGRKVLEDCEINGKLIPAGTNIGISPLYLGRREELFSEPNIFKP
ERFDVVTTAEKLNPYAYIPFSAGPRNCIGQKFAMLEIKAIVANVLRHYEVDFVGDSSEPP
VLIAELILRTKEPLMFKVRERVY
>4d2 AC017770 comp(32267-34028)
MLGVVGVLLLVAFATLLLWDFLWRRRGNGILPGPRPLPFLGNLLMYRGLDPEQIMDFVKK
NQRKYGRLYRVWILHQLAVFSTDPRDIEFVLSSQQHITKNNLYKLLNCWLGDGLLMSTGR
KWHGRRKIITPTFHFKILEQFVEIFDQQSAVMVEQLQSRADGMTPINIFPVICLTALDII
AETAMGTKINAQKNPNLPYVQAVNDVTNILIKRFIHAWQRVDWIFRLTQPTEAKRQDKAI
KVMHDFTENIIRERRETLVNNSKETTPEEEVNFLGQKRRMALLDVLLQSTIDGAPLSDED
IREEVDTFMFEGHDTTTSAISFCLYEISRHPEVQQRLQQEIRDVLGEDRKSPVTLRDLGE
LKFMENVIKESLRLHPPVPMIGRWFAEDVEIRGKHIPAGTNFTMGIFVLLRDPEYFESPD
EFRPERFDADVPQIHPYAYIPFSAGPRNCIGQKFAMLEMKSTVSKLLRHFELLPLGPEPR
HSMNIVLRSANGVHLGLKPRA
>4d8 AC017388 comp(37292-39859) also AC010557 AC010112 AC010113
MLLFLLVVLLFGAGWIIHLGQADRRRKVANLPGPICPPLIGAMQLMLRLNPKTFIKVGRE
YVLKFGHLQRVWIFNRLLIMSGDAELNEQLLSSQEHLVKHPVYKVLGQWLGNGLLLSDGK
VWHQRRKIITPTFHFSILEQFVEVFDQQSNICVQRLAQKANGNTFDVYRSICAAALDIIA
ETAMGTKIYAQANESTPYAEAVNECTALLSWRFMSVYLQVELLFTLTHPHLKWRQTQLIR
TMQEFTIKVIEKRRQALEDQQSKLMDTADEDVGSKRRMALLDVLLMSTVDGRPLTNDEIR
EEVDTFMFEGHDTTTSALSFCLHELSRHPEVQAKMLEEIVQVLGTDRSRPVSIRDLGELK
YMECVIKESLRMYPPVPIVGRKLQTDFKYTHSVHGDGVIPAGSEIIIGIFGVHRQPETFP
NPDEFIPERHENGSRVAPFKMIPFSAGPRNCIGQKFAQLEMKMMLAKIVREYELLPMGQR
VECIVNIVLRSETGFQLGMRKRKHN
>4d14 AC017770 35699-37438
MYLELFAILLATALAWDYMRKRRHNKMYAEAGIRGPKSYPLVGNAPLLINESPKTIFDMQ
FRLIAEFGKNIKTQMLGESGFMTADSKMIEAIMSSQQTIQKNNLYSLLVNWLGDGLLISQ
GKKWFRRRKIITPAFHFKILEDFVEVFDQQSATMVQKLYDRADGKTVINMFPVACLCAMD
IIAETAMGVKINAQLQPQFTYVQSVTTASAMLAERFMNPLQRLDFTMKLFYPKLLDKLND
AVKNMHDFTNSVITERRELLQKAIADGGDADAALLNDVGQKRRMALLDVLLKSTIDGAPL
SNDDIREEVDTFMFEGHDTTTSSIAFTCYLLARHPEVQARVFQEVRDVIGDDKSAPVTMK
LLGELKYLECVIKESLRLFPSVPIIGRYISQDTVLDGKLIPADSNVIILIYHAQRDPDYF
PDPEKFIPDRFSMERKGEISPFAYTPFSAGPRNCIGQKFAMLEMKSTISKMVRHFELLPL
GEEVQPVLNVILRSTTGINCGLKPRVY
>4d20 AC019509 comp(19731-21636)
MWLTLITGALILLLTWDFGRKRQRVLAFEKSAIPGPISIPILGCGLQALHLGAENIIGWV
GEKFDKYGKTFRFWILGESLIYTKDLQYFETILSSTTLLEKGQLYEYLRPFLNDGLLVST
GRKWHARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTAVDMLKYVSLAALD
VITEAAMGVQVNAQNDPDFPYIKALKSVVYIQPDRMFRFSRRYNWLFPLAAPLLHRQLLS
DIRVMHDFTDKVISERRETVRRAKADGTYRPLSLGDAEIGSKSQMALLDILLQSSINNQP
LSDADIREEVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLGPDASAPVTQ
AQLQDLKYLDCVIKETMRLYPPVPAIGRHAQKELEIGDKTIPANTSIYLVLYYAHRDANY
FPDPLSFRPERFLEDQEQGHNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFYELLP
LGEELKPMLNFILRSASGINVGLRPRKALR
>4d21 AC020004 55466-57280
MWILLGIAVLIMTLVWDNSRKQWRVNTFEKSRILGPFTIPIVGNGLQALTLRPENFIQRF
GDYFNKYGKTFRLWILGECLIYTKDLKYFESILSSSTLLKKAHLYRFLRDFLGDGLLLST
GNKWTSRRKVLAPAFHFKCLENFVEIMDRNSGIMVEKLKNYADGKTCVDLFKFVSLEALD
VTTETAMGVQVNAQNEPNFPYTKALKSVVYIESKRLASVSMRYNWLFPLAAPLVYRRLQK
DIAIMQDFTDKVIRERRAILERARADGTYKPLIMGDDDIGGKAKMTLLDILLQATIDNKP
LSDVDIREEVDVFIFAGDDTTTSGVSHALHAISRHPKVQECIYEELVSVLGPDPDASVTQ
TKLLELKYLDCVIKETMRLHPPVPILGRYIPEDLKIGEITIPGNTSILLMPYYVYRDPEY
FPDPLVFKPERWMDMKTTSNTPPLAYIPFSSGPKNCIGQKFANLQMKALISKVIRHYELL
PLGADLKATYTFILSSSTGNNVGLKPRTRVK
>4e1 AC020402 44580-46698
MWIVLCAFLALPLFLVTYFELGLLRRKRMLNKFQGPSMLPLVGNAHQMGNTPTEILNRFF
GWWHEYGKDNFRYWIGYYSNIMVTNPKYMEFILSSQTLISKSDVYDLTHPWLGLGLLTST
GSKWHKHRKMITPAFHFNILQDFHEVMNENSTKFIDQLKKVADGGNIFDFQEEAHYLTLD
VICDTAMGVSINAMENRSSSVVQAFKDITYTIKMRAFSPWKRNKYLFHFAPEYPEYSKTL
KTLQDFTNEIIAKRIEVRKSGLEVGIKADEFSRKKMAFLDTLLSSKVDGRPLTSQELYEE
VSTFMFEGHDTTTSGVGFAVYLLSRHPDEQEKLFNEQCDVMGASGLGRDATFQEISTMKH
LDLFIKEAQRLYPSVPFIGRFTEKDYVIDGDIVPKGTTLNLGLLMLGYNDRVFKDPHKFQ
PERFDREKPGPFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFEVLPALDELVSKDGY
ISTTLGLQPAEKKSRDAHNHKYDPILSASMTLKSENGLHLRMKQRLVCDST
>4e2 AC020402 41848-44099
MWFVLYIFLALPLLLVAYLELSTFRRRRVLNKFNGPRGLPLMGNAHQMGKNPSEILDTVF
SWWHQYGKDNFVFWIGTYSNVLVTSSKYLEFILSSQTLITKSDIYQLTHPWLGLGLLTST
GSKWHKHRKMITPAFHFNILQDFHEVMNENSTKFIKHLKTVAAGDNIFDFQEQAHYLTLD
VICDTAMGVSINAMENRSSSIVQAFKDMCYNINMRAFHPLKRNELLYRLAPDYPAYSRTL
KTLQDFTNEIIAKRIEAHKSGAVSTNAGDEFTRKKMAFLDTLLSSTIDGRPLNSKELYEE
VSTFMFEGHDTTTSGVSFAVYLLSRHQDEQRKLFKEQREVMGNSELGRDATFQEISQMKY
LDLFIKEAQRVYPSVPFIGRFTEKDYVIDGDLVPKGTTLNLGLVMLGYNEKVFKDPHKFR
PERFELEKPGPFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFEVLPALDELVSKDGY
ISTTIGLPDAERKKRDPYRHKYDPILSAVLTLKSENGLYIRLKERH
>4e3 AC020324 73117-75125
MWLAVLALLVLPLITLVYFERKASQRRQLLKEFNGPTPVPILGNANRIGKNPAEILSTFF
DWWYDYGKDNFLFWIGYSSHIVMTNPKQLEYILNSQQLIQKSTIYDLLHPWLGHGLLTSF
GSKWHKHRKMITPSFHFNILQDFHEVMNENSAKFMTQLKKASAGDTIIDFQEHANYLTLD
VICDTAMGVPINAMEQRDSSIVQAFRDMCYNINMRAFHPFKRSNRVFSLTPEFSAYQKTL
KTLQDFTYDIIEKRVYALQNGGSKEDHDPSLPRKKMAFLDTLLSSTIDGRPLTRQEIYEE
VSTFMFEGHDTTTSGVSFSVYLLSRHPDVQRKLYREQCEVMGHDMNRSVSFQEIAKMKYL
DLFIKEAQRVYPSVPFIGRYCDKDYDINGSIVPKGTTLNLALILLGYNDRIFKDPHHFRP
ERFEEEKPAPFEYLPFSAGPRNCIGQKFALLELKTVISKVVRSFEVLPAVDELVSTDGRL
NTYLGLAPDEKLKREAGRHKYDPILSAVLTLKSDNGLHLRLRERRS*
>4g1 AC020093 comp(33262-34932) no introns
MAVEVVQETLQQAASSSSTTVLGFSPMLTTLVGTLVAMALYEYWRRNSREYRMVANIPSP
PELPILGQAHVAAGLSNAEILAVGLGYLNKYGETMKAWLGNVLLVFLTNPSDIELILSGH
QHLTKAEEYRYFKPWFGDGLLISNGHHWRHHRKMIAPTFHQSILKSFVPTFVDHSKAVVA
RMGLEAGKSFDVHDYMSQTTVDILLSTAMGVKKLPEGNKSFEYAQAVVDMCDIIHKRQVK
LLYRLDSIYKFTKLREKGDRMMNIILGMTSKVVKDRKENFQEESRAIVEEISTPVASTPA
SKKEGLRDDLDDIDENDVGAKRRLALLDAMVEMAKNPDIEWNEKDIMDEVNTIMFEGHDT
TSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNMLRDCTFADTMEMKYLERVILETLRLY
PPVPLIARRLDYDLKLASGPYTVPKGTTVIVLQYCVHRRPDIYPNPTKFDPDNFLPERMA
NRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRNYIVHSTDTEADFKLQADIILKLE
NGFNVSLEKRQYATVA
>4g15 AC013897 comp(8972-10574 and 5306-6643) two pieces
MEVLKKDAALGSPSSVFYFLLLPTLVLWYIYWRLSRAHLYRLAGRLPGPRGLPIVGHLFD
VIGPASSVFRTVIRKSAPFEHIAKMWIGPKLVVFIYDPRDVELLLSSHVYIDKASEYKFF
KPWLGDGLLISTGQKWRSHRKLIAPTFHLNVLKSFIELFNENSRNVVRKLRAEDGRTFDC
HDYMSEATVEILLETAMGVSKKTQDKSGFEYAMAVMRMCDILHARHRSIFLRNEFVFTLT
RYYKEQGRLLNIIHGLTTKVIRSKKAAFEQGTRGSLAQCELKAAALEREREQNGGVDQTP
STAGSDEKDREKDKEKASPVAGLSYGQSAGLKDDLDVEDNDIGEKKRLAFLDLMLESAQN
GALITDTEIKEQVDTIMFEGHDTTAAGSSFFLSLMGIHQDIQDRVLAELDSIFGDSQRPA
TFQDTLEMKYLERCLMETLRMYPPVPLIARELQEDLKLNSGNYVIPRGATVTVATVLLHR
NPKVYANPNVFDPDNFLPERQANRHYYAFVPFSAGPRSCVGRKYAMLKLKILLSTILRNY
RVYSDLTESDFKLQADIILKREEGFRVRLQPRTS
>4p1 AC018129 comp(67703-69662)
MIILWLILALSALLYWLHRANKDYHILSFFTKRIRLKDGTPVEIIAPIAKGKTIFGNTLD
LYGRDHAGVFNYSRERAKEMGTSYIEYVFGKAIYNIIDADSAENVLNHPNLITKGLVYNF
LHPFLRTGLLTSTGKKWHARRKMLTPTFHFNILNQFQEIFKTESQKFLLQFEGQDEVTIT
LHDVIPRFTLNSICETAMGVKLDEMAEKGDRYRENFSQIEECFIRRLSNPLLWGDKLFEM
FAAKDFASALDVVHRFSSEIIAKRRDLLKDELDKSSSTADDDGFVSKKRFAMLDTLIYAE
KDGLIDHIGICEEVDTLMFEGYDTTSIGLIFGLMNMSLNPDKQELCYQEIQEHIDDDLSN
LDVGQLNKLKYLEYFMKETTRLFPSVPIMGREAVQETELANGLILPKGAQITIHVFDIHR
NAKYWDSPEEFRPERFLPENVQDRHTYAYVPFSAGQRNCIGKKYAMQEMKTLMVVLLKQF
KVLKAIDPQKIVFHTGITLRTQDKIRVKLVRRT
>4p2 AC018129 comp(70087-72192) revised 9/11/2000
MMICLLWISVAILVVIHWIYKVNKDYNILAFFARRVQTKDGKPLDSLVPMIKGRTVFANC
FDLLGKDTDQVFTHLRQLAKNSGDSYLQYSMGFSNFNVIDAHNAANILNHPNLITKGVIY
NFLHPFLRTGVLTATEKKWHTRRSMLTRTFHLDILNQFQEIFIAESLKFVSQFQGQNEVV
VSLKDRISRFTLNSICETAMGIKLDEMAEKGDRYRANFHIIDEGLTRRIVNPLYWDDCVY
NMFTGHKYNAALKVVHEFSREIIAKRRVLLEEELENRRATQTADDDICVIRKKRFAMLDT
LICAEKDGLIDDIGISEEVDTLMAEGYDTTSIGLVFGLMNMSLYAAEQELCYQEIQEHIL
DDLSNLNLSQLSKLNYLGYFIKETMRLYPSIPIMGRQTLQETELENGLILPKRSQINIHV
FDIHRNPKYWESPEEFRPERFLPQNCLKRHPYAYIPFSAGQRNCIGQKYAMQEMKTLMVV
ILKHFKILPVIDPKSIVFQVGITLRFKNKIKVKLVRRNCV
>4p3 AC018129 comp(65426-67385) revised 9/11/2000
MLILWLVGAFIVLIQWIYRLNRDYCILGFFAKRIRTKNGQNPESIAPLVKGSTIFANSFD
LYGKDHSGVFEHSRDCAKKLGKSYAEYAMGTAIYNVIDADSAERVLNDPNLINKGTIYDF
LHPFLRTGLLTSTGKKWHARRKMLSPTFHFNILNQFQEIFITESLKFLEQFKGNDEAIIS
LNEVIPRFTLNSICETAMGVKLDEMAEKGDRYRENFRQIEECFIRRMSNPLLWSDTLFKM
FAEKDYASALDVVHGFSSEIIAKRRDQLNDEIDSRGNTQTAEDELFTSKKRFAMLDTLIL
AEKDGLIDHIGICEEVDTLMFEGYDTTSIGLMFGLMNMSLYPEEQEKCYQEIQANIDDEL
NILNIGQLNKLKNLEYFIKETMRLFPSVPAMGRETTRETELSNGLILPKGSQIFVHVFDI
HRNPEYWDSPEEFRPERFLPENSQNRHTYAYIPFSAGQRNCIGQKFAMQEMKTLMVALLK
QFQILPEIDPKTIVFQTGLTLRTKNQIHVNS
>4s3 AC018488 comp(98620-101060) also AC015418 AC018487
MSTLALVAFVLWAAFLRYLPKILNFLRLQRFAKTLPGPTIGELIANVKKGEILNWLKELR
EKHGPVFRIWFGKDLMVMFTDPEDIKQLLGNNQLLTKSRNYELLEPWLGKGLLTNGGESW
HRRRKLLTPGFHFRILSEFKEPMEENCRILVRRLRTKANGESFDIYPYITLFALDAICET
AMGIKKHAQLQSDSEYVQAVQSICRVMHKQSFSFWQRLNVFFKHTKPGKEREAALKVLHD
ETNRVIRLRREQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAELSDTDIREE
VDTFMFEGHDTTSSAIAFALSLLSKNPDVQQRAFEEASELEGREKESMPYLEAVIKETLR
IYPSVPFFSRKVLEDLEVGKLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRFLVNEKQ
MHPFAFAAFSAGPRNCIGQKFAMLELKTSLAMLLRSYRFLPDKDHQPKPLAELVTKSGNG
IRLRILPRDENGTTA
>4aa1 AC020355 comp(15477-16779) and AC007579 comp(38212-38842)
MHLRLLSPPQLERTTNLELCSILILLVISLSIYTFYATLNTYLRSVLLSLRLTGPPSLPF
LGNCMLVTDKDLMRRCAGKAFDLYGSLVRIWVLLFPFFAVLEPEDLQVILSSKKHTNKVF
FYRLMHNFLGDGLITSSGSKWSNHRRLIQPAFHHNLLEKFIDTFVDASQSLYENLDAEAV
GTEINIAKYVNNCVLDILNEAVLGVPIKKRGQDVAMMEDSPFRQGKIMMPARFTQPWLLL
DGIYHWTKMANDELNQKKRLNDFTRKMIQRRRQIQNNNNGNSERKCLLDHMIEISESNRD
FTEEDIVNEACTFMLAGQDSVGAAVAFTLFLLTQNPECQDRCVLELATIFEDSNRAPTMT
DLHEMRYMEMCIKEALRLYPSVPLIARKLGEEVRLAKHTLPAGSNVFICPYATHRLAHIY
PDPEKFQPERFSPENSENRHPYAFLPFSAGPRYCIGNRFAIMEIKTIVSRLLRSYQLLPV
TGKTTIAATFRITLRASGGLWVRLKERDHPLIAH
>4ac1 AC017771 comp(24745-26507)
MWIALLGIPILLAVLTLLLKHINKTYFILSLTKRVRTEDGSPLESKVAIMPGKTRFGNNL
DILNFTPASVFNFVRESTAKAKGQNYLWYFLYAPMYNVVRPEEAEEVFQSTKLITKNVVY
ELIRPFLGDGLLISTDHKWHSRRKALTPAFHFNVLQSFLGIFKEECKKFLNVLEKNLDAE
LELNQVIPPFTLNNICETALGVKLDDMSEGNEYRKAIHAIEEVLIQRVCNPLMYYNWYFF
VYGDYRKHLQNLRIVHDFSSRIIERKRQQFQQKQLGEVDEFGRKQRYAMLDTLLAAEADG
QIDHQGICDEVNTFMFEGYDTTSTCLIFTLLMLALHEDVQKKCYEEVENLPEDSDDISMF
QFNKLVYLECVIKESLRMFPSVPFIGRQCVEETVVNGMVMPKDTQISIHIYDIMRDPRHF
PKPDLFQPDRFLPENTVNRHPFAYVPFSAGQRNCIGQKFAILEMKVLLAAVIRNFKLLPA
TQLEDLTFENGIVLRTQENIKVKLSKRVK*
>4ac2 AC017771 comp(22220-24109) revised 9/8/2000
MFLEVLFAAPLVIFIFRKLWAHLNRTYFILSLCKRIRTEDGSLLESKIYVAPSKTRFGNN
FDLVNFTSESIFNFMRDASAKAKGRNYLWYFFHAPMYNIVRAEEAEEILQSSKLITKNMI
YELLKPFLGEGLLISTDQKWHSRRKALTPAFHFKVLQSFLIIFKEECNKLVKVLHQSVNM
ELELNQVIPQFTLNNVCETALGVKLDDLSEGIRYRQSIHAIEEVMQQRLCNPFFYNIVYF
FLFGDYRKQVNNLKIAHEFSSNIIEKRRSLFKSNQLGQEDEFGKKQRYAMLDTLLAAEAD
GQIDHQGICDEVNTFMFEGYDTTSTCLIFTLLMLALHEDVQKKCYEEIKYLPDDSDDISV
FQFNELVYMECVIKESLRLFPSVPFIGRRCVEEGVVNGLIMPKNTQINIHLYEIMRDARH
FSNPKMFQPDRFFPENTVNRHPFAFVPFSAGQRNCIGQKFAILEIKVLLAAVIRNFKILP
VTLLDDLTFENGIVLRTKQNIKVKLVHRENK
>4ac3 AC017771 comp(20241-21996)
MWIALLGSSLLIGALWLLLRQLNKTYFILSLCKRVRTADGSPLESKVFVVPGKTRFGNNL
DLLNLTPANIFSYIRESTAKANGQNYIWNFLFAPEYNIVRAEDAEEIFQSTKITTKNMSY
ELIRPFLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESKKFIKILDKNVGFE
LELNQIIPQFTLNNICETALGVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFF
LFGDYKKYSRILRTIHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAAEAEG
KIDHQGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDEVSMF
QFNELIHLECVIKESLRLFPSAPIIGRTCIEESVMNGLVLPKNAQISIHIYDIMRDARHF
PKPNQFLPERFLPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLPA
TQLEDLTFENGIVLRTQQNIKVKFEARVK
>4ad1 AC020402 comp(36565-39829)
MFLIAIAIILATILVFKGVRIFNYIDHMAGIMEMIPGPTPYPFVGNLFQFGLKPAEYPKK
VLQYCRKYDFQGFRSLVFLQYHMMLSDPAEIQNILSSSSLLYKEHLYSFLRPWLGDGLLT
SSGARWLKHQKLYAPAFERSAIEGYLRVVHRTGGQFVQKLDVLSDTQEVFDAQELVAKCT
LDIVCENATGQDSSSLNGETSDLHGAIKDLCDVVQERTFSIVKRFDALFRLTSYYMKQRR
ALSLLRSELNRIISQRRHQLAAENTCQQGQPINKPFLDVLLTAKLDGKVLKEREIIEEVS
TFIFTGHDPIAAAISFTLYTLSRHSEIQQKAAEEQRRIFGENFAGEADLARLDQMHYLEL
IIRETLRLYPSVPLIARTNRNPIDINGTKVAKCTTVIMCLIAMGYNEKYFDDPCTFRPER
FENPTGNVGIEAFKSVPFSAGPRRCIAEKFAMYQMKALLSQLLRRFEILPAVDGLPPGIN
DHSREDCVPQSEYDPVLNIRVTLKSENGIQIRLRKR
>4ae1 old 4e4 AL009194 16210-17867
MLVVLLVALLVTRLVASLFRLALKELRHPLQGVVPSVSRVPLLGAAWQMRSFQPDNLHDK
FAEYVKRFGRSFMGTVLGHVVMVTAEPRHIDALLQGQHQLKKGTMYFALRGWLGDGLLLS
RGKEWHTMRKIITPTFHFSILEQFVEVFDRQSSILVERLRTLSYGNEVVNIYPLVGLAAL
DIITETAMGVNVDAQGADSEVVHAVKDLTNILATRFMRPHLLFPHLFRLCWPSGFRKQQA
GVICLHEFTNGIIEQRRRLLAREANQDKPTKPHALLDTLLRATVDGQPLTDKQIRDEVNT
FIFEGHDTTTSAVSFCLYLLSRHEAVQQKLFEELRMHYGQDLFRGVILSDFATLPYLSCV
VKESLRLYPPIPAVARCLEKDLVIDEGYIPVGTNVVVLLWQLLRDEAIFTDPLVFQPERH
LGEEAPRLSPYSYIPFSAGPRNCIGQKFALLEMKTMVTKVIRHYQLLPMGADVEPSIKIV
LRSKSGVNVGLRPRLY
>6a2 AC007549 comp(100072-101661)
MFVLIYLLIAISSLLAYLYHRNFNYWNRRGVPHDAPHPLYGNMVGFRKNRVMHDFFYDYY
NKYRKSGFPFVGFYFLHKPAAFIVDTQLAKNILIKDFSNFADRGQFHNGRDDPLTQHLFN
LDGKKWKDMRQRLTPTFTSGKMKFMFPTVIKVSEEFVKVITEQVPAAQNGAVLEIKELMA
RFTTDVIGTCAFGIECNTLRTPVSDFRTMGQKVFTDMRHGKLLTMFVFSFPKLASRLRMR
MMPEDVHQFFMRLVNDTIALRERENFKRNDFMNLLIELKQKGRVTLDNGEVIEGMDIGEL
AAQVFVFYVAGFETSSSTMSYCLYELAQNQDIQDRLRNEIQTVLEEQEGQLTYESIKAMT
YLNQVISETLRLYTLVPHLERKALNDYVVPGHEKLVIEKGTQVIIPACAYHRDEDLYPNP
ETFDPERFSPEKVAARESVEWLPFGDGPRNCIGMRFGQMQARIGLAQIISRFRVSVCDTT
EIPLKYSPMSIVLGTVGGIYLRVERI
>6a8 AC020447 comp(122688-124264)
MALTYILFQVAVALLAILTYYIHRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQ
DHYNKFRESKAPFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDDPISAH
LFNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVLEIRDLVA
RFTVDVIGTCAFGIQCNSLRDEKAEFLYFGKRSLVDKRHGTLLNGFMRSYPKLARKLGMV
RTAPHIQEFYSRIVTETVAVREKEHIKRNDFMDMLIELKNQKEMTLENGDVVRGLTMEEV
LAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQHDQNFTYECTKDLK
YLNQVLDETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYPEP
FEFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCSKT
PNPLVYDPKSFVLGVKDGIYLKVETV
>6a9 AC020447 comp(115043-116610)
MGVYSVLLAIVVVLVGYLLLKWRRALHYWQNLDIPCEEPHILMGSLTGVQTSRSFSAIWM
DYYNKFRGTGPFAGFYWFQRPGILVLDISLAKLILIKEFNKFTDRGFYHNTEDDPLSGQL
FLLDGQKWKSMRSKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQAMEKSPIVEVRDILAR
FTTDVIGTCAFGIECSSLKDPEAEFRVMGRRAIFEQRHGPIGIAFINSFQNLARRLHMKI
TLEEAEHFFLRIVRETVAFREKNNIRRNDFMDQLIDLKNSPLTKSESGESVNLTIEEMAA
QAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKECQEVIGKYNGEITYESMKDMVYL
DQVISETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNT
FNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLINRFKFSVCEQTTI
PIVYSKKTFLISSETGIFLKVERV
>6a13 AC020451 3757-5238 also AC007085 126189-124714 no introns
MLTLLVLVFTVGLLLYVKLRWHYSYWSRRGVAGERPVYFRGNMSGLGRDLHWTDINLRIY
RKFRGVERYCGYFTFMTKSLFIMDLELIRDIMIRDFSSFADRGLFHNVRDDPLTGNLLFL
DGPEWRWLRQNLTQVFTSGKMKFMFPNMVEVGEKLTQACRLQVGEIEAKDLCARFTTDVI
GSCAFGLECNSLQDPESQFRRMGRSVTQEPLHSVLVQAFMFAQPELARKLRFRLFRPEVS
EFFLDTVRQTLDYRRRENIHRNDLIQLLMELGEEGVKDALSFEQIAAQALVFFLAGFDTS
STTMSFCLYELALNPDVQERLRVEVLAVLKRNNQKLTYDSVQEMPYLDQVVAETLRKYPI
LPHLLRRSTKEYQIPNSNLILEPGSKIIIPVHSIHHDPELYPDPEKFDPSRFEPEEIKAR
HPFAYLPFGEGPRNCIGERFGKLQVKVGLVYLLRDFKFSRSEKTQIPLKFSSRNFLISTQ
EGVHLRMEGLERP
>6a14 AC007085 33266-34850 frameshift at amino acid 73 possible pseudogene
MLFTIALVGVVLGLAYSLHIKIFSYWKRKGVPHETPLPIVGNMRGIVKKYHFRDINQRIY
KKFKGQGPIAGMYTFFKRTALITDLDFIKQVMIKDFSYFQDRGAFTNPRDDPLTGHLFAL
EGEEWRAMRHKLTPVFTSGKIKQMSKVIVDVGLRLGDAMDKAVKEAKVEEGNVEIKDLCA
RFTTDVIGSCAFGLECNSLQDPSAEFRQKGREIFTRRRHSTLVQSFIFTNARLARKLRIK
VLPDDLTQFFMSTVKNTVDYRLKNGIKRNDFIEQMIELRAEDQEAAKKGQGIDLSHGLTL
EQMAAQAFVFFVAGFETSSSTMSLCLYELALQPDIQQRLREEIESVLANVDGGELNYDVL
AQMTYLDQVLSETLRKHPLLPHLIRETTKDYQIPNSDIVLDKGILALIPVHNIHHDPEIY
PEPEKFDPSRFDPEEVKNRHPMAYLPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFSVS
NRTDVPLIFSKKSFLLTTNDGIYLKVERV
>6a15p this is a pseudogene on AC020451 2595-3373 with in frame
stops and frame shifts
AFTVTNSKLAKKLKMKILRDDLTDFFLSVVKPALSGMTLWTSPPSGGRSSRQGGSKFDLS
HNWTLEQMAAQAIVFFLAGFETSSSTMSSCKYELALQPEI*NQIRDEIERVLEGNAITYD
ALAKINYPEQVLSETLRKHPIQLIKFLLETQESFRVRNTELIVEKGTSLLIPVHSVHYDP
HLYPHPKLFDSSRLKAYKSNSRHPFAYLPFGTFGPRSCIGLRFGKMQAKIGIVSLCQRFK
FGDSDLTDIPL
>6a16 AC004721 comp(2956-5070)
MDFTLLLLTSLLSFLLGYLRYRFTYWELRGIPQLRPHFLFGHFFRLQSVHYSELLQETYD
AFRGSAKVAGTYVFLRPMAVVLDLDLVKAVLIRDFNNFVDRRSFHGDPLTANLFNLQGEE
WRNLRTKLSPTFTSGKMKYMFGTVSTVAQQLGGTFDELVGSQGAVLELHDLMARYTTDVI
GSCAFGTECSSLREPQAEFRQVGRRIFRNSNRSIRWRIFKMTYLSSLAKLGLPVRILHPD
ITKFFNRIVRETVELRERENIRRNDFMDLLLDLRRKGLTMEQMAAQAFVFFVAGFETSSS
NMSYALFELAKNQDVQQKLRMEINDSIGKHGKLTYEAMMEMPYLDQTITETLRKYPALSS
LTRLASEDYEIPSPDGGDPVVLEKGTSVHIPVLAIHYDPEVYPEPHEFRPERFAPDACRE
RHPTAFLGFGDGPRNCIGLRFGRMQVKVGLITLLRRFRFSLPPGSPTQLKVTKRNLILLP
SDGVRLQVDPVESRLM
>6a17 AC020447 109264-110826
MLLLALIVVILSLLVFAARRRHGYWQRRGIPHDEVHPLFGNIKDWPNKRHIAEIFRDYYF
KYKNSDYPFAGFFFFFTRTAVVTDMELLKRVLIKDFNHFENRGVFYNEIDDPLSATLFSI
EGQKWRHLRHKLTPTFTSGKMKNMFPIVVKVGEEMDKVFRSKTAADRGQVLEVVDLVARY
TADVIGNCAFGLNCNSLYDPKAEFVSIGKRAITEHRYGNMLDIFLFGFPKLSRRLRLKLN
IQEAEDFYTKIVRETIDYRLRTKEKRNDFMDSLIEMYKNEQSGNSEDGLTFNELLAQAFI
FFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVFGKHNKEFTYEGIKEMKYLEQVV
METLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPDIYPEPEIFKPER
FTDEEIAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPETQIPMKIV
VKNILISAENGIHLKVEKLAK
>6a18 AC008285 85740-87319
MQLTYFLFQVAVALLAIVTYILHRKLTYFKRRGIPYDKPHPLRGNMEGYKKTRTVHEIHQ
EYYNKYRNSKAPFVGFYLFQKPAAFVIDLELAKQILIKNFSNFTDKGIYYNEKDDPMSAH
LFNLDGPQWRLLRSKLSSTFTSGKMKFMYPTVVSVAEEFMAVMHEKVSENSILDVRDLVA
RFTVDVIGTCAFGIKCNSLRDEKAEFLHFGRRALLDSRHGNLVSGLMRSYPNLARRLGLC
RNTAQIQEFYQRIVKETVTLREKENIKRNDFMDMLIGLKNQKNMTLENGEVVKGLTMDEI
VAQAFVFFIAGFDTSSSTMGFALYELAKNPSIQDKVRAELGQVLEQHDQKFTYECIKDLK
YLDQVINETLRHYTIVPNVDRVAAKRFVVPGNPKFVIEAGQSVIIPSSAIHHDPSIYPEP
NEFRPERFSPEESAKRPSVAWLPFGEGPRNCIGLRFGQMQARIGLAMLIKNFTFSPCSAT
PDPLTFDPHSAILLGIKGGIQLKVEAI
>6a19 AC020447 113084-114646
MAILLGLVVGVLTLVAWWVLQNYTYWKRRGIPHDPPNIPLGNTGELWRTMPLAGILKRTY
LKFRKQTDGPFAGFYLYAMKYIVITDVDFVKTVLIRDFDKFHDRGVYHNEKDDPLTNNLA
TIEGQKWKNLRQKLTHTFTSAKMKSMFSTVLNVGDEMIRVVDEKISSSSQTLEVTDIVSR
FTSDVIGICAFGLKCNSLRDPKAEFVQMGYSALRERRHGWLVDLLIFGMPKLAVKLGFQF
LLPSVQKFYMKIVQDTIDYRMKRKVTRNDFMDTLIDMKQQYDKGDKENGLAFNEVAAQAF
VFFLAGFEAGSTTMGFTLYELACNQDVQDKLRAEIDSVLERYNGKLEYDSMQDLFYMEKV
INESLRKHPVVAHLARIATKPYQHSNPKYFIEAGTGVLVSTLGIHHDPEFYPEPEKFIPE
RFDEEQVKKRPTCAFLPFGAGPRNCIGLRFGRMQVIIGLALLIHNFRFELHPKTPVPMKY
TINNLLLGSEGGIHLNITKVVRD
>6a20 AC020447 117416-119045 this seq has a frame shift at NKLR-NKTD
MAVMIVLLIGVITFVAWYVHQHFNYWKRRGIPHDEPKIPYGNTSELMKTVHFADIFKRTY
NKLRNKTDGPFVGFYMYFKRMVVVTDIDFAKTVLIREFDKFHDRGVFHNERDDPLSANLV
NIDGQKWKTLRQKLTPTFTSGKMKTMFPTILTVGDELIRVFGETASADSDSMEITNVVAR
FTADVIGSCAFGLDCHSLSDPKAKFVQMGTTAITERRHGKSMDLLLFGAPELAAKLRMKA
TVQEVEDFYMNIIRDTVDYRVKNNVKRHDFVDMLIEMKLKFDNGDKENGLTFNEIAAQAF
IFFLAGFETSSTTMGFALYELACHQDIQDKLRTEINTVLKQHNGKLDYDSMREMTYLEKV
IDETMRKRPVVGHLIRVATQHYQHTNPKYNIEKGTGVIVPTLAIHHDPEFYPEPEKFIPE
RFDEDQVQQRPACTFLPFGDGPRNCIGLRFGRMQVIVGMALLIHNFKFEFHPTKTVVPLE
YRTDDFLLSSKGGIHLKVTRV
>6a21 AC020447 comp(120585-122149)
MSVGTVLLTALLALVGYLLMKWRSTMRHWQDLGIPCEEPHILMGSMKGVRTARSFNEIWT
SYYNKFRGSGPFAGFYWFRRPAVFVLETSLAKQILIKEFNKFTDRGFFHNPEDDPLSGQL
FLLDGQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVAKSPVVEVRELLAR
FTTDVIGTCAFGIECSSLKDPDAEFREMGRRSLTEQRLGPVGIGFVNSFPNLARRLHMKM
TAEPIERFFMRIVRETVAFREQNNIRRNDFMDQLIDLKNKPLMVSQSGESVNLTIEEIAA
QAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCNGELNYESMKDLVYL
DQVVSETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNT
FNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEKTTI
PMTYNKEMFLIASNSGIYLKAERV
>6a22 AC020447 106987-108653
MLDVVALLLIALAVGFWFVRTRYSYWTRRGIGSEPARFPVGNMEGFRKNKHFIDIVTPIY
EKFKGNGAPFAGFFMMLRPVVLVTDLELAKQILIQDFANFEDRGMYHNERDDPLTGHLFR
IDGPKWRPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQVCGELADNAMCGILEIGDLMAR
YTSDVIGRCAFGVECNGLRNPEAEFAIMGRRAFSERRHCKLVDGFIESFPEVARFLRMRQ
IHQDITDFYVGIVRETVKQREEQGIVRSDFMNLLIEMKQRGELTIEEMAAQAFIFFAAGF
DTSASTLGFALYELAKQPALQAKLREEIDQALRLHNGEFTYDSMQELRYMELVIAETLRK
YPILPQLTRISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHKFIPERFLADQ
LAQRPTAAWLPFGDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTDPKIEFLKSNIL
LCPANGIYLKVQQLSQMSS
>6a23 AC020447 111145-112718
MSLLLTLIALLVSLLLFMARRRHGYWQRRGIPHDVPHPIYGNMKDWPKKRHIAMIFRDYY
TKYKRSVYPFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENRGIFYNEIDDPLSATLFS
IEGQKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAKTTTGEGQVLEIVDLVAR
YTADVIGNCAFGLNCNSLQNPNAEFVTIGKRAIIERRYGGLLDFLIFGFPKLSRRLRLKL
NVQDVEDFYTSIVRNTIDYRLRTNEKRHDFMDSLIEMYEKEQAGNTEDGLSFNEILAQAF
IFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEGIKEMKYLEQV
VMETLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYPEPEKFKPE
RFTDEAIAARPSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVSTETQIPMKF
VVKSILLSAENGIHLKVEKLSK
>6d2 AC020206 comp(66328-68065) also AC008350
MWTILLTILIAGLLYRYVKRHYTHWQRLGVDEEPAKIPFGVMDTVMKQERSLGMALADIY
ARHEGKIVGIYMLNKRSILIRDAQLARQIMTSDFASFHDRGVYVDEDKDPLSANLFNLRG
ASWRNLRQKLTPSFSSGKIKGMFGTIDDVGDKLVQHLEGALDQSDEVEIKDVMTTYAVDI
IGSVIFGLEIDSFRNPKNEFREISSSTSRDESLLLKIHNMSMFICPPIAKLMNRLGYESR
ILTSLRDMMKRTIEFREEHNVVRKDMLQLLIRLRNTGKIGEDDDQVWDMETAQEQLKSMS
IEKIAAQAFLFYVAGSESTAAASAFTLYELSMYPELLKEAQEEVDAVLMKHNLKPKDRFT
YEAVQDLKFLDICIMETIRKYPGLPFLNRECTEDYPVPGTNHIIAKGTPILISLFGMQRD
PVYFPNPNGYDPHRFDSNNMNYDQAAYMPFGEGPRHCIALRMGKVNSKVAVAKILANFDL
VQSPRKEVEFRFDAAPVLVTKEPLKLRLTKRK
>6d4 AC017250 37993-39657 also AC008197 AC009846
MFSLILLAVTLLTLAWFYLKRHYEYWERRGFPFEKHSGIPFGCLDSVWRQEKSMGLAIYD
VYVKSKERVLGIYLLFRPAVLIRDADLARRVLAQDFASFHDRGVYVDEERDPLSANIFSL
RGQSWRSMRHMLSPCFTSGKLKSMFSTSEDIGDKMVAHLQKELPEEGFKEVDIKKVMQNY
AIDIIASTIFGLDVNSFENPDNKFRKLVSLARANNRFNAMFGMMIFLVPSIAQFLFRIGF
KNPVGLAMLQIVKETVEYREKHGIVRKDLLQLLIQLRNTGKIDENDEKSFSIQKTPDGHI
KTISLEAITAQAFIFYIAGQETTGSTAAFTIYELAQYPELLKRLQDEVDETLAKNDGKIT
YDSLNKMEFLDLCVQETIRKYPGLPILNRECTQDYTVPDTNHVIPKGTPVVISLYGIHHD
AEYFPDPETYDPERFSEESRNYNPTAFMPFGEGPRICIAQRMGRINSKLAIIKILQNFNV
EVMSRSEIEFENSGIALIPKHGVRVRLSKRVPKLS
>6d5 AC018176 comp(132649-134791)
MIGIYLLIAAVTLLYVYLKWTFSYWDRKGFPSTGVSIPFGALESVTKGKRSFGMAIYDMY
KSTKEPVIGLYLTLRPALLVRDAQLAHDVLVKDFASFHDRGVYVDEKNDPMSASLFQMEG
ASWRALRNKLTPSFTSGKLKAMFETSDSVGDKLVDSIRKQLPANGAKELELKKLMATYAI
DIIATTIFGLDVDSFADPNNEFQIISKKVNRNNIEDIIRGTSSFLYPGLEKFFVKIGWKQ
EATERMRELSNRTVDLREQNNIVRKDLLQLLLQLRNQGKINTDDNIWSAESTKNGVKSMS
KDLIAGQLFLFYVAGYETTASTTSFTLYELTQNPEVMEKAKEDVRSAIEKHGGKLTYDAI
SDMKYLEACILETARKYPALPLLNRICTKDYPVPDSKLVIQKGTPIIISLIGMHRDEEYF
PDPLAYKPERYLENGKDYTQAAYLPFGEGPRMCIGARMGKVNVKIAIAKVLSNFDLEIRK
EKCEIEFGVYGIPLMPKSGVPVRLSLKK
>6g1 AC015208 comp(21239-22935) also AC007440
MVLTEVLFVVVAALVALYTWFQRNHSYWQRKGIPYIPPTPIIGNTKVVFKMENSFGMHLS
EIYNDPRLKDEAVVGIYSMNKPGLIIRDIELIKSILIKDFNRFHNRYARCDPHGDPLGYN
NLFFVRDAHWKGIRTKLTPVFTSGKVKQMYTLMQEIGKDLELALQRRGEKNSGSFITEIK
EICAQFSTDSIATIAFGIRANSLENPNAEFRNYGRKMFTFTVARAKDFFVAFFLPKLVSL
MRIQFFTADFSHFMRSTIGHVMEERERSGLLRNDLIDVLVSLRKEAAAEPSKPHYAKNQD
FLVAQAGVFFTAGFETSSSTMSFALYEMAKHPEMQKRLRDEINEALVEGGGSLSYEKIQS
LEYLAMVVDEVLRMYPVLPFLDREYESVEGQPDLSLKPFYDYTLENGTPVFIPIYALHHD
PKYWTNPSQFDPERFSPANRKNIVAMAYQPFGSGPHNCIGSRIGLLQSKLGLVSLLKNHS
VRNCEATMKDMKFDPKGFVLQADGGIHLEIVNDRLYDQSAPSLQ
>6g2 AC015208 19014-20624
MELVLLILVASLIGIAFLALQQHYSYWRRMGVREIRPKWIVGNLMGLLNMRMSPAEFISQ
LYNHPDAENEPFVGIHVFHKPALLLRDPEMVRNILVKDFAGFSNRYSSSDPKGDPLGSQN
IFFLKNPAWKEVRLKLSPFFTGNRLKQMFPLIEEVGASLDAHLRQQPLHNERMRCFDLEA
KELCALYTTDVIATVAYGVSANSFTDPKCEFRRHGRSVFEFNLLRAAEFTLVFFLPHLVP
FVRFKVVPAEATRFLRKTINYVMSEREKSGQKRNDLIDILIEFRRSTQLAKASGIKDQFV
FEGDILVAQAVLFFTAGFESSSSTMAFAMYELAKDTDVQQRLREEIKDALVESGGQVTLK
MIESLEFMQMILLEVLRMYPPLPFLDRECTSGRDYSLAPFHKKFVVPKGMPVYIPCYALH
MDPQYFPQPRKFLPERFSPENRKLHTPYTYMPFGLGPHGCIGERFGYLQAKVGLVNLLRN
HMITTSERTPHRMQLDPKAIITQAKGGIHLRLVRDALGV
>6t1 AC012831 comp(42975-44564) no introns
MIAVFSLIAAALAVGSLVLLPVVLRGGCLLVVTIVWLWQILHFWHWRRLGVPFVPAAPFV
GNVWNLLRGACCFGDQFRELYESKEAAGRAFVGIDVLHNHALLLRDPALIKRIMVEDFAQ
FSSRFETTDPTCDTMGSQNLFFSKYETWRETHKIFAPFFAAGKVRNMYGLLENIGQKLEE
HMEQKLSGRDSMELEVKQLCALFTTDIIASLAFGIEAHSLQNPEAEFRRMCIEVNDPRPK
RLLHLFTMFFFPRLSHRVGTHLYSEEYERFMRKSMDYVLSQRAESGENRHDLIDIFLQLK
RTEPAESIIHRPDFFAAQAAFLLLAGFDTSSSTITFALYELAKNTTIQDRLRTELRAALQ
SSQDRQLSCDTVTGLVYLRQVVDEVLRLYPPTAFLDRCCNSRTGYDLSPWNGGSPFKLRA
GTPVYISVLGIHRDAQYWPNPEVFDPERFSAEQRQQHHPMTYLPFGAGPRGCIGTLLGQL
EIKVGLLHILNHFRVEVCERTLPEMRFDPKAFVLTAHNGTYLRFVKNSL
>6t2p AC014742 1042-2504
VETAACCFGDQFRELYERKEAAGRAIVGINVLHSHALLLRDPALIRRILVEDFPEFSSSF
KSTDAIRDTMGSGNLLFTKYKTWWETHKIFAIRLGGRRIRSLLYGLLERI*QNLEAHMAQ
KLNGAESVELEVKQLCALFTTDIFAKFALQSLQNPEAEFRPMCIEVNDPKPKRLSHHLFT
HRPDFYVAQAAFLLLAGFDTSSSFALYELAKNPTIEHRLQAELRVDLQSSHNHQLSYDTL
TGLVYLRQVLEDLPFGAGPRGCIGTLLGQLGIKVGLLHTLKHFRVELCERTLPEMRFDP*
ASVLTAHNGTFLRFVRNSL*
>6t3 AC015208 comp(17123-18689)
MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQ
LYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNRFESADAGDPMGALTL
PLAKYHHWKESRQCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLPLGRM
CQLYTTDVTGNLFYSLNVGGLRRGRSELITKTKELFNTNPRKVLDFMSVFFLPKWTGVLK
PKVFTEDYARYMRHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLA
GFETSSALMGFTLYELAKAPDIQERLRSELREAFISTATLSYDTLMTLPYLKMVCLEALR
LYPAAAFVNRECTSSASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPER
FGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVETCERTVSEIRFN
PKSFMLESENEIYLRFCRSSL
>6u1 AC017706 15959-17471 also AC008288
MHRTLLTALGELSVVYALVKFSLGYWKRRGILHEKPKFLWGNIKGVVSGKRHAQDALQDI
YTAYKGRAPFVGFYACLKPFILALDLKLVHQIIFTDAGHFTSRGLYSNPSGEPLSHNLLQ
LDGHKWRSLHAKSAEVFTPANMQKLLVRLSQISSRIQRDLGEKSLQTINISELVGAYNTD
VMASMAFGLVGQDNVEFAKWTRNYWADFRMWQAYLALEFPLIARLLQYKSYAEPATAYFQ
KVALSQLQLHRRRDRQPLQTFLQLYSNAEKPLTDIEIAGQAFGFVLAGLGPLNATLAFCL
YELARQPEVQDRTRLEINKALEEHGGQVTPECLRELRYTKQVLNETLRLHTPHPFLLRRA
TKEFEVPGSVFVIAKGNNVLIPTAAIHMDPGIYENPQRFYPERFEEQARRSRPAAAFLPF
GDGLRGCIAARFAEQQLLVGLVALLRQHRYAPSAETSIPVEYDNRRLLLMPKSDIKLSVE
RVDKL
>6v1 AC011761 comp(54926-57766) also AC015002
MVYSTNILLAIVTILTGVFIWSRRTYVYWQRRRVKFVQPTHLLGNLSRVLRLEESFALQL
RRFYFDERFRNEPVVGIYLFHQPALLIRDLQLVRTVLVEDFVSFSNRFAKCDGRSDKMGA
LSLFLAKQPEWREIRTRLAPAFAGAKLKQMFSLMEEIGCDLEWYLKRLTRDLRRGDAERG
AIVSIKDVCDLYNTDMIASIAFGLRSYSLRNTQSEIGSHCQDLFRPNVRRIIDLFVIFYL
PKLVPLLRPKLFTEPHAEFLRRVIQLVIEERERGGDLRNDLIEMLLTLKKEADLQQDKSH
FTHHRDFLAAQAASFEVAGIETCSASMSFALYELAKQPLMQSRLRREIREAFASNPNGRL
TYEAVARMEFLDMVVEETLRKYPIVPLLERECTPINKKRFYSLRPHAECYTRRGMPVFIS
NLAIHHDPKYWPDPDRFDPERFSAANKALQAPMSYMPFGAGPRNCIGMQIGLLQIKLGLV
YFLHQHRVEICDRTVERIQFDAKFALLASEQRIYLKVDCL
>6w1 AC014226 comp(15025-16689) also AC008257
MLLLLLLGSLTIVFYIWQRRTLSFWERHGVKYIRPFPVVGCTREFLTAKVPFFEQIQKFH
EAPGFENEPFVGVYMTHRPALVIRDLELIKTVMIKKFQYFNNRVLQTDPHNDALGYKNLF
FARSPGWRELRTKISPVFTSGKIKQMYPLMVKIGKNLQDSAERLGSGTEVQVKDLCSRFT
TDLIATIAFGVEANALQDAKSEFFYHNRAIFSLTLSRGIDFAIIFMIPALASLARVKLFS
RETTKFIRSSVNYVLKERERTGEKRNDLIDILLALKREAAANPGKMSKEVDLDYLVAQAA
VFQTAGFETSASTMTMTLYELAKNEALQDRLRQEIVDFFGDEDHISYERIQEMPYLSQVV
NETLRKYPIVGYIERECSQPAEGERFTLEPFHNMELPHGMSIYMSTVAVHRDPQYWPDPE
KYDPERFNSSNRDNLNMDAYMPFGVGPRNCIGMRLGLLQSKLGLVHILRNHRFHTCDKTI
KKIEWAPTSPVMASKRDIILRVEKVSGKKDFGQK
>9b1 AC019916 10502-12238
MSFVEICLVLATIGLLLFKWSTGTFKAFEGRNLYFEKPYPFLGNMAASALQKASFQKQIS
EFYNRTRHHKLVGLFNLRTPMIQINDPQLIKKICVKDFDHFPNHQTLNIPNERLVNDMLN
VMRDQHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAFELDMKV
LCNKLSNDVIATTAFGLKVNSFDDPENEFHTIGKTLAFSRGLPFLKFMMCLLAPKVFNFF
KLTIFDSTNVEYFVRLVVDAMQYREKHNITRPDMIQLLMEAKKESKDNWTDDEIVAQCFI
FFFAAFENNSNLICTTAYELLRNLDIQERLYEEVKETQEALKGAPLTYDAAQEMTYMDMV
ISESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDERFFPQPQR
FDPERFSERRKKDLIPYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKIEASPRTTR
DMWESARGFNIIPTTGFWMQLVSRK
>9b2 AC019916 8190-9903
MALIEICLALVVIGYLIYKWSTATFKTFEERKLYFEKPYPFVGNMAAAALQKSSFQRQLT
EFYERTRQHKLVGFFNMRTPMITLNDPELIKKVCVKDFDHFPNHQPFITSNDRLFNDMLS
VMRDQRWKHMRNTLTPVFTAAKMRNMFTLMNESFAECLQHLDSSSKTLPGRKGFEVDMKV
MCNKLSNDIIATTAFGLKVNSYDNPKNEFYEIGQSLVFSRGLQFFKFMLSTLVPKLFS
LLKLTIFDSAKVDYFA RLVVEAMQYREKHNITRPDMIQLLMEAKNESEDKWTDDEIVAQCFI
FFFAAFENNSNLICTTTYELLYNPDVQERLYEEIVETKKALNGAPLTYDAVQKMTYMDMV
ISESLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKVGDRINIPISGLHLDDRYFPEPRK
FDPDRFSEERKGDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLFNLLLHYKIEASPRTIK
DLWGSASGFNFTPRSGFWMHLVPRK
>9c1 AC019937 comp(1757-3443)
MVFVELSIFVAFIGLLLYKWSVYTFGYFSKRGVAHEKPIPLLGNIPWSVLMGKESYIKHS
IDLHLRLKQHKVYGVFNLRDPLYYLSDPELIRQVGIKNFDTFTNHRKGITEGFNDTSVIS
KSLLSLRDRRWKQMRSTLTPTFTSLKIRQMFELIHFCNVEAVDFVQRQLDAGTSELELKD
FFTRYTNDVIATAAFGIQVNSFKDPNNEFFSIGQRISEFTFWGGLKVMLYILMPKLMK
ALRVPVMDMNNVDYFK
KLVFGAMKYRKEQSIVRPDMIHLLMEAQRQFKAEQEGSAESAAQQD
KAEFNDDDLLAQCLLFFSAGFETVATCLSFTSYELMMNPEVQEKLLAEILAVKEQLGEKP
LDYDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQLKDEEGEVVVNLREDDLVHINV
GALHHDPDNFPEPEQFRPERFDEEHKHEIRQFTYLPFGVGQRSCIGNRLALMEVKSLIFQ
LVLRYHLKPTDRTPADMMSSISGFRLLPRELFWCKLESRGPA
>9f2 AC017132 AC017240 AC009741 AC017170 AC007594 PLUS ESTs
revised 9/11/2000
MLWEFFALFAIAAALFYRWASANNDFFKDRGIAYEKPVLYFGNMAGMFLRKRAMFDIVCD
LYTKGGSKKFFGIFEQRQPLLMVRDPDLIKQITIKDFDHFINHRNVFATSSDDDPHDMSN
LFGSSLFSMRDARWKDMRSTLSPAFTGSKMRQMFQLMNQVAKEAVDCLKQDDSRVQENEL
DMKDYCTRFTNDVIASTAFGLQVNSFKDRENTFYQMGKKLTTFTFLQSMKFMLFFALKGL
NKILKVELFDRKSTQYFVRLVLDAMKYRQEHNIVRPDMINMLMEARGIIQTEKTKASAVR
EWSDRDIVAQCFVFFFAGFETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQDLEGKELT
YEAIMGMKYLDQVVNEVLRKWPAAIAVDRECNKDITFDVDGQKVEVKKGDVIWLPTCGFH
RDPKYFENPMKFDPERFSDENKESIQPFTYFPFGLGQRNCIGSRFALLEAKAVIYYLLKD
YRFAPAKKSCIPLELITSGFQLSPKGGFWIKLVQRN
>9f3p AC017132 AC017240 AC009741 AC017170 AC007594 PLUS ESTs
revised 9/11/2000
MLWEFLALFAIATALFYRWASANNDFFKDRGIAYEKPVLYLGNMAGMFLRKRAMLDIVCD
LYTKGGSGKFFGIFAQRQPLLMVRDPDLIKQITIKDFDHFINHRNEFDTSSDDDPHDMSN
LFSSSLFSMRDARWKDMRSTLSPAFTGSKMRQMFQLMNQVAKEAVDCLKQDDSRVQENEL
DMKDYCTRFTNDVIASTAFGLQVNSFKDRENTFYQMGKKLTTFTFLQNMKFILLFALKSL
NKILKVEIFDRKSTQYFVRLVLDAMKYRQEHNIVRPDMINMLMEARGIIQTEKTKASAVR
EWSDRDIVAQCFVFFFAGFETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQDLEGKELK
YLDQVVSEVLRKWPPAIAFDRECNKEAKAVIYYLLKDYRFAPAKKSCIPLELISSGFQLS
PKGGFWIKLVQRN
>9h1 AC017648 8657-10342 also AC005450
MDQSMIALALFIILLVLLYKWSVAKYDVFSERGVSHEKPWPLIGNIPLKAMIGGMPVLKK
MIELHTKHTGSPVYGIYALRDAVFFVRDPELIKLIGIKEFDHFVNHNSMHNNIQESILSK
SLISLRDGRWKEMRNILTPAFTGSKMRIMYDLIQSCSEEGVIHIQEQLELSQDASIELEM
KDYFTRFANDVIATVAFGISINSFRRKDNEFFRIGQAMSRISAWSVVKAMLYALFPRLMK
VLRIQVLDTKNIDYFSSLVTAAMRYRQEHKVVRPDMIHLLMEAKQQRLADLSDKSKDELY
YSEFTADDLLAQCLLFFFAGFEIISSSLCFLTHELCLNPTVQDRLYEEIISVHEELKGQP
LTYDKLTKMKYLDMVVLEALRKWPPSISTDRECRQDIDLFDENGQKLFSARKGDVLQIPI
FSLHHDPENFEDPEFFNPERFADGHALESRVYMPFGVGPRNCIGNRMALMELKSIVYQLL
LNFKLLPAKRTSRDLLNDIRGHGLKPKNGFWLKFEARQ
>12a4 AC006091 85973-87865 also AC015190 AC008141 rev 9/11/2000
EST AI109374
MLKVRSALSLIQSQKATLSLATQKRWQTNVATAEAREDSEW
LQAKPFEQIPRLNMWALSMKMSMPGGKYKNMELMEMFEAMRQDYGDIFFMPGIMGNPPFL
STHNPQDFEVVFRNEGVWPNRPGNYTLLYHREEYRKDFYQGVMGVIPTQGKPWGDFRTVV
NPVLMQPKNVRLYYKKMSQVNQEFVQRILELRDPDTLEAPDDFIDTINRWTLESVSVVAL
DKQLGLLKNSNKESEALKLFHYLDEFFIVSIDLEMKPSPWRYIKTPKLKRLMRALDGIQE
VTLAYVDEAIERLDKEAKEGVVRPENEQSVLEKLLKVDRKVATVMAMDMLMAGVDTTSST
FTALLLCLAKNPEKQARLREEVMKVLPNKNSEFTEASMKNVPYLRACIKESQRLHPLIVG
NARVLARDAVLSGYRVPAGTYVNIVPLNALTRDEYFPQASEFLPERWLRSPKDSESKCPA
NELKSTNPFVFLPFGFGPRMCVGKRIVEMELELGTARLIRNFNVEFNYPTENAFRSALIN
LPNIPLKFKFIDLPN
>12a5 AC006091 83449-85296 also AC015190 AC008141
MLKGRIALNILQSQKPIVFSASQQRWQTNVPTAEIRNDPEWLQAKPFEEIPKANILSLFA
KSALPGGKYKNLEMMEMIDALRQDYGNIIFLPGMMGRDGLVMTHNPKDFEVVFRNEGVWP
FRPGSDILRYHRTVYRKDFFDGVQGIIPSQGKSWGDFRSIVNPVLMQPKNVRLYFKKMSQ
VNQEFVELIKEIRDASTQEVPGNFLETINRWTLESVSVVALDKQLGLLRESGKNSEATKL
FKYLDEFFLHSADLEMKPSLWRYFKTPLLKKMLRTMDSVQEVTLKYVDEAIERLEKEAKE
GVVRPEHEQSVLEKLLKVDKKVATVMAMDMLMAGVDTTSSTFTALLLCLAKNPEKQARLR
EEVMKVLPNKDSEFTEASMKNVPYLRACIKESQRVYPLVIGNARGLTRDSVISGYRVPAG
TIVSMIPINSLYSEEYFPKPTEFLPERWLRNASDSAGKCPANDLKTKNPFVFLPFGFGPR
MCVGKRIVEMELELGTARLIRNFNVEFNHSTKNAFRSALINLPNIPLKFKFTDVPN
>12b2 AC018326 7227-9141 also AC004345 AC004657
MWKYSNKIIYRNVSGNQLWFNRNSSVGGTLSQQVRSWQKEQELLKSRNLFTNNGYICSQT
QLELADSRIDEKWQQARSFGEIPGPSLLRMLSFFMPGGALRNTNLIQMNRLMREMYGDIY
CIPGMMGKPNAVFTYNPDDFEMTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVGGLASD
QGQEWADIRNKVNPVLMKVQNVRQNLPQLDQISKEFIDKLETQRNPETHTLTTDFHNQLK
MWAFESISFVALNTRMGLLSDNPDPNADRLAKHMRDFFNYSFQFDVQPSIWTFYKTAGFK
KFLKTYDNITDITSNYIETAMRGFGKNDDGKTKCVLEQLLEHNKKVAVTMVMDMLMAGID
TTSSACLTILYHLARNPSKQEKLRRELLRILPTTKDSLTDQNTKNMPYLRACIKEGLRIT
SITPGNFRITPKDLVLSGYQVPRGTGVLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPD
IQACPAARTRNPFVYLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKVSWLPETPIEYES
TIILSPCGDIRFKLEPVGDLM
>12c1 AC009385 comp(57935-59646) also AC012807
MLRLTVKHGLRANSQLAATRNPDASSYVQQLESEWEGAKPFTELPGPTRWQLFRGFQKGG
EYHQLGMDDVMRLYKKQFGDICLIPGLFGMPSTVFTFNVETFEKVYRTEGQWPVRGGAEP
VIHYRNKRKDEFFKNCMGLFGNGAEWGKNRSAVNPVLMQHRNVAIYLKPMQRVNRQFVNR
IREIRDKESQEVPGDFMNTINHLTFESVATVALDRELGLLREANPPPEASKLFKNIEVLM
DSFFDLGVRPSLYRYIPTPTYKKFSRAMDEIFDTCSMYVNQAIERIDRKSSQGDSNDHKS
VLEQLLQIDRKLAVVMAMDMLMGGVDTTSTAISGILLNLAKNPEKQQRLREEVLSKLTSL
HSEFTVEDMKSLPYLRAVIKESLRLYPVTFGNARSAGADVVLDGYRIPKGTKLLMTNSFL
LKDDRLYPRAKEFIPERWLRRKDDDKSDVLMNKDLNAFIYLPFGFGPRMCVGKRIVDLEM
ELTVANLVRNFHIEYNYSTEKPYKCRFLYKPNIPLKFKFTDLKY
>12d1 AC008187 comp(84371-86114)
MNTLSSARSVAIYVGPVRSSRSASVLAHEQAKSSITEEHKTYDEIPRPNKFKFMRAFMPG
GEFQNASITEYTSAMRKRYGDIYVMPGMFGRKDWVTTFNTKDIEMVFRNEGIWPRRDGLD
SIVYFREHVRPDVYGEVQGLVASQNEAWGKLRSAINPIFMQPRGLRMYYEPLSNINNEFI
ERIKEIRDPKTLEVPEDFTDEISRLVFESLGLVAFDRQMGLIRKNRDNSDALTLFQTSRD
IFRLTFKLDIQPSMWKIISTPTYRKMKRTLNDSLNVAQKMLKENQDALEKRRQAGEKINS
NSMLERLMEIDPKVAVIMSLDILFAGVDATATLLSAVLLCLSKHPDKQAKLREELLSIMP
TKDSLLNEENMKDMPYLRAVIKETLRYYPNGLGTMRTCQNDVILSGYRVPKGTTVLLGSN
VLMKEATYYPRPDEFLPERWLRDPETGKKMQVSPFTFLPFGFGPRMCIGKRVVDLEMETT
VAKLIRNFHVEFNRDASRPFKTMFVMEPAITFPFKFTDIEQ
>12e1 AC018294 2070-3932
MLSTQWNANKQISRQIYQLCRGLAQKVRKIYFKYIFILNLEEAKPYADIPGPSKLQLIRA
FLPGGLYKNLPVHEMFLDMNRQYGSIFRMPSVAGTDLVLTMNPQDYEVIFRNEGQYPYRR
SFEVMDYFKRVHRREVFDGYDGLTSGNGPAWGKMRTAVNPILLQPRNAKLYMTNLVQVSD
EFLERIRIIRDPVTQEMPDDFAVDIRHLVIESICSVALNTHLGLLGEQRNNKDIQKLVLA
LQDVVELGFQLDIMPAFWKYLPMPNFKKLMRSLDTITDFCYFHIGNALKRIEEDAKAGTL
NEIGLETSLLEKLARFDRQTAVIIAMDLLFAGADPTLVTLGGILFSLSKSPDKQARLLEE
IRGILPNKDSSLTIENMRNLPYLRACIKEGIRMYPIGPGTLRRMPHDVVLSGYRVVAGTD
VGIAANYQMANMEQFVPKVREFIPERWLRDESNSHLVGETATPFMYLPFGFGPRSCAGKR
IVDMMLEIAISRLVRNFKIGFDYPIENAFKAQFFVQPNIPFKFKFIERNE
>18a1 AC012164 114600-117669 also AC015216
MLADSYLIKFVLRQLQVQQDGDAQHLLMVFLGLLALVTLLQWLVRNYRELRKLPPGPWGL
PVIGYLLFMGSEKHTRFMELAKQYGSLFSTRLGSQLTVVMSDYKMIRECFRREEFTGRPD
TPFMQTLNGYGIINSTGKLWKDQRRFLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGH
LHASDGQPVDMSPVISVAVSNVICSLMMSTRFSIDDPKFRRFNFLIEEGMRLFGEIHTVD
YIPTMQCFPSISTAKNKIAQNRAEMQRFYQDVIDDHKRSFDPNNIRDLVDFYLCEIEKAK
AEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQ
VVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIP
LINSVHMDPNLWEKPEEFRPSRFIDTEGKVRKPEYFIPFGVGRRMCLGDVLARMELFLFF
ASFMHCFDIALPEGQPLPSLKGNVGATITPESFKVCLKRRPLGPTAADPHHMRNVGAN
>28a5 AC018242 6065-8082 also AC001660
MVLITLTLVSLVVGLLYAVLVWNYDYWRKRGVPGPKPKLLCGNYPNMFTMKRHAIYDLDD
IYRQYKNKYDAVGIFGSRSPQLLVINPALARRVFVSNFKNFHDNEIAKNIDEKTDFIFAN
NPFSLTGEKWKTRRADVTPGLTMGRIKTVYPVTNKVCQKLTEWVEKQLRLGSKDGIDAKH
MSLCFTTEMVTDCVLGLGAESFSDKPTPIMSKINDLFNQPWTFVLFFILTSSFPSLSHLI
KLRFVPVDVERFFVDLMGSAVETRRAQLAAGKQFERSDFLDYILQLGEKRNLDNRQLLAY
SMTFLLDGFETTATVLAHILLNLGRNKEAQNLLREEIRSHLQDGTIAFEKLSDLPYLDAC
VQETIRLFPPGFMSNKLCTESIEIPNKEGPNFVVEKGTTVVVPHYCFMLDEEFFPNPQSF
QPERFLEPDAAKTFRERGVFMGFGDGPRVCIGMRFATVQIKAAIVELISKFNVKINDKTR
KDNDYEPGQIITGLRGGIWLDLEKL*
>28c1 AC014191 comp(8254-10002) also AL133495
MFGSLLLGIATLLGAIYAFLVSNFGHWRRRGVTEPRALPLFGSFPNMIWPRQHFTMDMRD
IYMHYRNTHSYVGCYLLRAPKLLVLEPRLVYEIYVSAFSHFENNDASKMVDIAKDRLVAL
NPFVLEGEEWRHQRAVFSTLLTNGRIRTTHAIMQRVCLDLCQFIAIKSAGGKDLDCIDLG
LRFTGESLFDCVLGIQARTFTDNPLPVVRQNHEMSAENRGLAIAGAVHGLFPNLPRWLRP
KVFPRSHDRFYGQMISEALRLRRSKHQERNDFINHLLEMQRELDLSEEDMASHAMTFMFD
GLDTTSNSIAHCLLLLGRNPDCQRRLYEELQLVNPGGYLPDLDALIDLPYLSACFNESLR
IYPAGGWASKTCTKEYELRGSHHSEPLKLRPGDHVMVPIYALHNDPDLYPEPDVFRPERF
LDGGLKNCKQQGIFLGFGNGPRQCVGMRLGLAMAKAALAAIVQRFEVVVSPRTLNGTELD
PLIFVGVHKGGIWLQFVPRKNVTTK
>28d1 AC017780 comp(28385-30262) also AC009355 AC008324 AC008327
MCPISTALFVIAAILALIYVFLTWNFSYWKKRGIPTAKSWPFVGSFPSVFTQKRNVVYDI
DEIYEQYKNTDSIVGVFQTRIPQLMVTTPEYAHKIYVSDFRSFHDNEMAKFTDSKTDPIL
ANNPFVLTGEAWKERRAEVTPGLSANRVKAAYPVSLRVCKKFVEYIRRQSLMAPAQGLNA
KDLCLCYTTEVISDCVLGISAQSFTDNPTPMVGMTKRVFEQSFGFIFYTVVANLWPPITK
FYSVSLFAKDVAAFFYDLMQKCIQVRRESPAAQQRDDFLNYMLQLQEKKGLNAAELTSHT
MTFLTDGFETTAQVLTHTLLFLARNPKEQMKLREEIGTAELTFEQISELPFTEACIHETL
RIFSPVLAARKVVTEPCELTNKNGVSVKLRPGDVVIIPVNALHHDPQYYEEPQSFKPERF
LNINGGAKKYRDQGLFFGFGDGPRICPGMRFSLTQIKAALVEIVRNFDIKVNPKTRKDNE
IDDTYFMPALKGGVWLDFVERN
>28d2 AC017780 comp(31545-33456) AC008324 revised 9/11/2000
MCPVTTFLVLVLTLLVLVYVFLTWNFNYWRKRGIKTAPTWPFVGSFPSIFTRKRNIAYDI
DDIYEKYKDTDNMVGVFTTRVPQLLVMCPEYIHKIYATDFRSFHNNEWRNFVNKKTDM
ILGNNPFVLTGDEWKERRSEIMPALSPNRVKAVYPVSQSVCKKFVEYIRRQQQMATSEGL
DAMDLSLCYTTEVVSDCGLGVSAQSFTDTPTPLLKMIKRVFNTSFEFIFYSVVTNLWQKV
RKFYSVPFFNKETEVFFLDIIRRCITLRLEKPEQQRDDFLNYMLQLQEKKGLHTDNILIN
TMTFILDGFETTALVLAHIMLMLGRNPEEQDKVRKEIGSADLTFDQMSELPHLDACIYET
LRLFSPQVAARKLVTEPFEFANKNGRTVHLKPGDVVTIPVKALHHDPQYYEDPLTFKPER
FLESNGGGMKSYRDRGVYLAFGDGPRHCPGMRFALTQLKAALVEILRNFEIKVNPKTRSD
NQIDDTFFMATLKGGIYLDFKDL
>49a1 AC017930 48452-54739 AC007398 AC007418 ESTs AA941795 AI258819 AA697999
revised at intron 3 9/6/2000. 13 exons
MQRLRTGESSNPKKLNVSQQPVTSVATTRTTASSLPAETTSSPAAAVRPYSEVPGPYPLP
LIGNSWRFAPLIGTYKISDLDKVMNELHVNYGKMAKVGGLIGHPDLLFVFDGDEIRNIFK
KEEAMPHRPSMPSLRHYKGDLRRDFFGDVAGLIGVHGPKWEAFRQEVQHILLQPQTAKKY
IPPLNDIASEFMGRIELMRDEKDELPANFLHELYKWALESVGRVSLDTRLGCLSPEGSEE
AQQIIEAINTFFWAVPELELRMPLWRIYPTKAYRSFVKALDQFTAICMKNIGKTMDKADA
DEARGLSKSEADISIVERIVRKTGNRKLAAILALDLFLVGVDTTSVAASSTIYQLAKNPD
KQKKLFDELQKVFPHREADINQNVLEQMPYLRACVKETLRMRPVVIANGRSLQSDAVING
YHVPKGTHVIFPHLVVSNDPAYFPEPKRFLPERWLKQSTDAAGCPHANQKIHPFVSLPFG
FGRRMCVGRRFAEIELHTLLAKIFRKYKVSYNSGEFVYRVNSTYIPQSPLNFKLTLRDE
>301a1 AC017275 comp(35594-38192) also AC007356
MNNLSLKAWRSTVSCGPNLRQCVPRISGAGSRRAQCRESSTGVATCPHLADSEEASAPRI
HSTSEWQNALPYNQIPGPKPIPILGNTWRLMPIIGQYTISDVAKISSLLHDRYGRIVRFG
GLIGRPDLLFIYDADEIEKCYRSEGPTPFRPSMPSLVKYKSVVRKDFFGDLGGVVGVHGE
PWREFRSRVQKPVLQLSTIRRYLQPLEVITEDFLVRCENLLDENQELPEDFDNEIHKWSL
ECIGRVALDTRLGCLESNLKPDSEPQQIIDAAKYALRNVATLELKAPYWRYFPTPLWTRY
VKNMNFFVGVCMKYIQSATERLKTQDPSLRAGEPSLVEKVILSQKDEKIATIMALDLILV
GIDTISMAVCSMLYQLATRPVDQQKVHEELKRLLPDPNTPLTIPLLDQMHHLKGFIKEVF
RMYSTVIGNGRTLMEDSVICGYQVPKGVQAVFPTIVTGNMEEYVTDAATFRPERWLKPQH
GGTPGKLHPFASLPYGYGARMCLGRRFADLEMQILLAKLLRNYKLEYNHKPLDYAVTFMY
APDGPLRFKMTRV
>302a1 AC015396 31954-33705
MLTKLLKISCTSRQCTFAKPYQAIPGPRGPFGMGNLYNYLPGIGSYSWLRLHQAGQDKYE
KYGAIVRETIVPGQDIVWLYDPKDIALLLNERDCPQRRSHLALAQYRKSRPDVYKTTGLL
PTNGPEWWRIRAQVQKELSAPKSVRNFVRQVDGVTKEFIRFLQESRNGGAIDMLPKLTRL
NLELTCLLTFGARLQSFTAQEQDPRSRSTRLMDAAETTNSCILPTDQGLQLWRFLETPSF
RKLSQAQSYMESVALELVEENVRNGSVGSSLISAYVKNPELDRSDVVGTAADLLLAGIDT
TSYASAFLLYHIARNPEVQQKLHEEARRVLPSAKDELSMDALRTDITYTRAVLKESLRLN
PIAVGVGRILNQDAIFSGYFVPKGTTVVTQNMVACRLEQHFQDPLRFQPDRWLQHRSALN
PYLVLPFGHGMRACIARRLAEQNMHILLLRLLREYELIWSGSDDEMGVKTLLINKPDAPV
LIDLRLRRE
>303a1 AC017306 12933-14444 no introns
MFYTVIWIFCATLLAILFGGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVF
ARQYVNPYGFYGLKIGKDKVVIAYTNDAISEMMTNEDIDGRPDGIFYRLRTFNSRLGVLL
TDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHD
LTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNF
SGYNGFVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKGMFSDQSL
LAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLP
YCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPES
FNPDRYLFDGHLKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPE
EVPLEGATAAVKPYDIMLVAREQ
>304a1 AC008359 comp(80887-82836) also AC014292 AC009393
MITETLLTICAAVFLCLSYRYAVGRPSGFPPGPPKIPLFGSYLFMLIINFKYLHKAALTL
SRWYKSDIIGLHVGPFPVAVVHSADGVREILNNQVFDGRPQLFVAAMRDPGQDVRGIFFQ
DGPLWKEQRRFILRYLRDFGFGRRFDQLELVIQEQLNDMLDLIRNGPKYPHEHEMVKSGG
YRVLLPLLFNPFSANAHFYIVYNECLSREEMGKLVKLCQMGIQFQRNADDYGKMLSIIPW
IRHIWPEWSGYNKLNESNLFVRQFFADFVDKYLDSYEEGVERNFMDVYIAEMRRGPGYGF
NRDQLIMGLVDFSFPAFTAIGVQLSLLVQYLMLYPAVLRRVQNEIDEVVGCGRLPNLEDR
KNLPFTEATIREGLRIETLVPSDVPHKALEDTELLGYRIPKDTIVVPSLYAFHSDARIWS
DPEQFRPERFLDADGKLCLKLDVSLPFGAGKRLCAGETFARNMLFLVTATMCQHFDFVLG
PNDRLPDLSQNLNGLIISPPDFWLQLQDRH
>305a1 AC018013 comp(34574-37224)
MSALIFLCAILIGFVIYSLISSARRPKNFPPGPRFVPWLGNTLQFRKEASAVGGQHILFE
RWAKDFRSDLVGLKLGREYVVVALGHEMVKEVQLQEVFEGRPDNFFLRLRTMGTRKGITC
TDGQLWYEHRHFAMKQMRNVGYGRSQMEHHIELEAEELLGQLERTEEQPIEPVTWLAQSV
LNVLWCLIAGKRIARQEDGTLRRLLDLMNRRSKLFDICGGLLAQFPWLRHVAPDRTGYNL
IQQLNTELYGFFMDTIEEHRRQLAKDPSPAESDLIYAYLQEMKDRSAGGESSTFNETQLV
MTILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTASVAAASTDAFPHLSRREAF
DYMDAFIMEVQRFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPL
EFRPERFIDSAGKCFKDEYFMPFGMGRRRCLGDALARACIFSFLVRIVQHFSVVLPAGES
PSMVLLPGITLTPKPYKVQFVKRT
>306a1 AC012373 154223-156412 also AC015216 AC012164 AC012376
MSADIVDIGHTGWMPSVQSLSILLVPGALVLVILYLCERQCNDLMGAPPPGPWGLPFLGY
LPFLDARAPHKSLQKLAKRYGGIFELKMGRVPTVVLSDAALVRDFFRRDVMTGRAPLYLT
HGIMGGFGIICAQEDIWRHARRETIDWLKALGMTRRPGELRARLERRIARGVDECVRLFD
TEAKKSCASEVNPLPALHHSLGNIINDLVFGITYKRDDPDWLYLQRLQEEGVKLIGVSGV
VNFLPWLRHLPANVRNIRFLLEGKAKTHAIYDRIVEACGQRLKEKQKVFKELQEQKRLQR
QLEKEQLRQSKEADPSQEQSEADEDDEESDEEDTYEPECILEHFLAVRDTDSQLYCDDQL
RHLLADLFGAGVDTSLATLRWFLLYLAREQRCQRRLHELLLPLGPSPTLEELEPLAYLRA
CISETMRIRSVVPLGIPHGCKENFVVGDYFIKGGSMIVCSEWAIHMDPVAFPEPEEFRPE
RFLTADGAYQAPPQFIPFSSGYRMCPGEEMARMILTLFTGRILRRFHLELPSGTEVDMAG
ESGITLTPTPHMLRFTKLPAVEMRHAPDGAVVQD
>307a1 AC014810 comp(54284-52654) also AC007840 revised 9/8/2000
MLAALIYTILAILLSVLATSYICIIYGVKRRVLQPVKTKNSTEINHNAYQKYTQAPGPRP
WPIIGNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKV
MSGRPDFIRYHKLFGGERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCE
EMEHWNRELGNQLVPGEPINIKPLILKACANMFSQYMCSLRFDYDDVDFQQIVQYFDEIF
WEINQGHPLDFLPWLYPFYQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEPDRDFTD
ALLKSLLEDKDVSRNTIIFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRIQEEIDAII
EEENRSINLLDMNAMPYTMATIFEVLRYSSSPIVPHVATEDTVISGYGVTKGTIVFINNY
VLNTSEKFWVNPKEFNPLRFLEPDNEKLQLKRNIPHFLPFSIGKRTCIGQNLVRGFGFLV
VVNVMQRYNISSHNPSTIKISPESLALPADCFPLVLTPREKIGPL
Note there is a small intron between LEP ccgt agt DNEK
No other animal P450 has an insertion here
>307a2p AC019383 comp(3284-3706) AL078186
MLTSVFYVLFAIAITIILISYVFLLLKCKQKAFVVIGLLYQEKKYQCFDQAPGPHPWPII
GNINLLGRFQYNPFYGFGTLTKKYGDIYSLSLGHTRCIVVNNVDLIKEVLNKNGKYFGGR
PDFFRYHKLFGGDRNNCKFIXXLRF
>308a1 AC015216 72624-74273 also AC012164
MLPLVLFILLAATLLFWKWQGNHWRRLGLEAPFGWPLVGNMLDFALGRRSYGEIYQEIYT
RNPGLKYVGFYRLFNEPAILVRDQELLRQILVGRNFADCADNAVYVDHQRDVLASHNPFI
ANGDRWRVLRADLVPLFTPSRVRQTLPHVARACQLLRDQVPLGRFEAKDLATRYTLQVVA
SAIFGLDAHCLGIHMRVAHEPSRWLEWLAPLFQPSVWSLLETMSLLHTPRLGRLIGHRYV
PLPLQHWFRELVEARSGGDNLLQWLAESKRGLGKEELAGHATTLLLEGYETSAMLLAFAL
YELALNEDAQRRLHIELDEVAQRHAGNLIDPVALGELRYSEAALLEALRLHPAMQALQKR
CTKTFTLPDQKSGASSELKVHLGTVLVLPVQAIHLDPALYPAPNQFRPERFLNQPPMGCR
FLGFGAGPRMCPGMRLGLLQTKAALTTLLQDHCVQLADEDQCRVEVSPLTFLTASRNGIW
LSFKRRTRRY
>309a1 AC019891 comp(47437-49308) also AC009909
MFTLVGLCLTIVHVAFAVVYFYLTWYHKYWDKRGVVTAEPLTILGSYPGILINKSRSLIL
DVQDVYNKYKDKYRTVGTFITRQPQLLVLDPALAHEILVDKFSHFRDTITSSFVGHNPDD
KYVAGSPFFSAGDKWKRLRSENVGGLTPSRLKMAYSIWEQSGRKLVEYIERARREQGDII
ETRDLAYRFTANAMADFIWGIDAGSLSGKVGEIGDFQKTSTDWSAHAFSSMIRFNKTLVA
IFVRKLFSMRFFTKATDEFFLRLTQDAVNLRQGGSGEGRTDYLSHLIQLQQRGNSIHDSV
GHALTVHLDGFETSGAVLYHMLYSLSEHHEEQEKLRSEILEALASEGQISYDQINNLPYL
DQCFNESLRLTTPIGFFMRICTKPTQINLGDDKTLDLEPGVTVMVPAYQYHHDNDIYPEA
SEFRPDRFENGAASVLTKRGCFLPFGDGPRICLGMRVGQLSVKTAIVHILSNYQVEQMKK
VPLGADSGMGIFLNGDVELKYTKLQK
>309a2 AC009909 45541-45982 also AC019977
MYILASLALILLHLLVLPIYLYLTWHHKYWRKRGLVTARPLTLLGTYPGLLTRKSNLVFD
VQKIYDKYKGKHRAVGVFVTRQPQILVLDPELAHEVLVSNFRCYKDSLQSSYLRHAKWDK
YARLNPFWASGQSWRRLRTDAQAGISGSRLRQAYNIWEQGGQMLTEYMTQQVAEKNNILE
TRDLCFRYTAHVMADFIWGIDAGTLTRPMEQPNKVQEMASKWTSYAFYMLTLFMATIVAP
CSRLLLRFRFYPKETDEFFSNLTKESIELRLKAGDSTRTDYLSHLLQLRDQKQATHDDLV
GHALTVMLDGYDTSGTALLHALYYLAENPAVQQKLRVEILSCMASEKSLDFEKLSSLQYL
EQCFNESLRLSSLIPQYTKVCTLPTVIRLSESKSLDVEVGMTIMIPNYQFHHDKQYFPEP
EAFKPERFDNGAYQELMRKGIFLPFSDGPRICMGVPLAMLTLKSALVHILSNFQVVRGRD
RLIPKGDSGFGVVLQGDVNLEYRRFFR
>310a1 AC017690 comp(12877-14650)
MWLLLPILLYSAVFLSVRHIYSHWRRRGFPSEKAGITWSFLQKAYRREFRHVEAICEAYQ
SGKDRLLGIYCFFRPVLLVRNVELAQTILQQSNGHFSELKWDYISGYRRFNLLEKLAPMF
GTKRLSEMFGQVQKVGDHLIHHLLDRQGQGCPQEVDIQQKLRVYSVNIIANLIYGLDINN
FEHEDHILTSYLSHSQASIQSFTLGRLPQKSSYTYRLRDLIKQSVELREDHGLIRKDILQ
LLVRFRNGNEVSGDKWQLEPINDADKLLSIKRLAKVAEDLLKVSLDAVASTVTFTLLEIL
QEPLIVEKLRAEIKELSNENGQLKFEELNGLRYMDMCLKETLRKYPPLPIIERVCRKSYS
LPNSKFTIDEGKTLMVPLLAMHRDEKYFSEPMKYKPLRFLQTANDVGQCEDKTKSNVFIG
FGIGGSQCVGQNFAKLVIKVALIKLLQNFHLELDANQVKTLKVSHRPAPFIHTKDGLKVK
LKRREINTKFYS
>311a1 AC014186 2270-3910
MALWPLLLITLTIWILVRKWTLLRLGSSLPGPWAFPLLGNAQMVGKLRPEYIFLVFTELR
DRFGATYRLRLGPQLWVFLHSAEETRQALHDPTLRKADTFMQLEPLIGNGLLISHGAHWT
RQRRLLTPAFQPQLLRSFAPAIGGHVERLVGRLGATRGAFLEVTEPLFACLLDAIVDTSM
GAQLDTQSVDHSPIIQAFHLSSKLLFKRMINPLLSSDWIFQRTQLWRDLDEQLQVIHSQM
ESVIEKRAKELLDMGEPAGRAHNLLDTLLLAKFEGQSLSRREIRDEINTFVFAGVDTTTA
AMSFVLYALAKFPETQTRLRKELQDVALDETTDLDALNGLPYLEALIKEVLRLYTIVPTT
GRQTTQSTEIGGRTYCAGVTLWINMYGLAHDKEYYPDPYAFKPERWLPEDGAVAPPAFSY
IPFSGGPHVCIGRRYSLLLMKLLTARLVREFQMELSPEQAPLRLEAQMVLKAQQGINVSF
LKQ
>312a1 AC015424 57845-59744 also AC009369 AC007573 AC010003
MFWLGFGLLLLALSLYLLYVFERQSRIDRLTHKWPAPPALPFIGHLHILAKLVGPHPLRR
ATEMINEHLHDHRAKLWMGTKLYLVDCNPKDIQALCSAQQLLQKTNDYRVFENWLCEGLF
TSGFEKWSHRRKIVMPAFNYTMIKQFVAVFEKQSRILLTNVAKFAESGDQIDFLQLISCF
TLDTICETALGVSVGSQSSAKSEYLDAVKSILVIIDKRLKNIFYRNSFIFKRTSHYKREQ
ELIKTLHGFTEGIIQKRIDEINQDAENRNYQSSDAELDGVKRTLCFLDTLLLSKGPDGKP
LTVKDIREEVDTIIFGGFDLTATTLNFFMYNMTLHPEHQQRCREEVWSVCGKDKSEPISI
EQVRQLEFLEACIKETLRMYPSGPLTARKATANCTINDFFIPKGSDVIISPIYMGRCKDF
FPDPMVFKPDRWAIGAEPKIEATTFIPFMAGARSCMGQRYAMVMLKMVLAHLLRNFLFEP
LGERQVKLKLNFVITLHTVEPYLCRAKNLD
>313a1 AC017740 comp(167857-169728) also AC007809 AC007928
revised 9/11/2000
MLTINLLLAVGALFWIYFLWSRRRLYFLMLKIPGPIGLPILGSSLENIITYKRKLSFRTK
YLNKYGSTILTWMGPVPFIVTRDPKVVEDIFSSPDCHNKSQHIVNAITSCMGNGLLGKQD
PHWLDRRKHFNPSFKQDLLLSFFHIFDAETKVLMNLLDTYVDKGEIDVVPEMLRWSFKIA
AQTTMGSEVKHDEHFKNGSLVESFESLISHSTLNILMPLVQNRMISKICGYDKLRADNFS
RIQKMLDNVVNKKVNPLPKTDSDPESNIVINRAMELYRKGDITYMDVKSECCIMIAAGYD
TSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGHFGITYPDMQKLDYLERVIKETLRL
IPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNFLAENM
EQKHPYAYIPFARGKRNCIGSKYAMMSSKFALCRILRNYKISTSTLYKDLVYVDNMTMKL
AEYPRLKLQRRG
>313a2 AC017371 4100-5929 AC007724 AL057969 AL067059 rev. 9/8/2000
MIVIQLLIAASLILWIRFLWSRRKLYMLMMQLPGRMGLPLLGNSVRYLIISRGKMSSRTT
YMDKHGSTYMAWIGTTPIVITRDPKIAEKVLTSPFCINRSSQTTNALALSMGYGLLTLQ
GSKWMARRKHMNPAFKHSVLLSFLPIFNAETDLLVSVFDSFVGQGEKDVLSDLIRWSFAI
ATQTTLGTDVTKDDNFENDAILKTYQSMLRLTIINIFVPFVQNKIVSKLFGLEWLRRRDA
SAINKMINNILDKKLNSNPENYCESELKTVIHRAIELFRNDEMSLMELGAECSSMVLAAF
ETSAHTVYYALVLLAMFPEHQEMVFNEIKEHFPLAKGIEVTHTDLQQLVYLDRVLNETLR
LMPSVPFSSRETLEDLRLSNGVVIPKGMTISIDIFNTQRNTDYWGSEAAQFNPENFLPEK
IHDRHPYAFIPFSKGKRNCIGWRYGLMSSKLALVKILRNYKLKTSFPYENLEFVDHMVIK
LAQSPQLAFERRTL*
>313a3 AC017371 1890-3720 also AC007724
MDTFQLLLAVGVCFWIYFLWSRRRLYMMHFKIPGPMGLPILGIAFEYLITYKRKMSIRTK
YMDIYGSTCLVWVGPTPFVITRDPKIAEEIFLSPECLNRSSIFSKPVNSCTGDGLLSLEA
SKWVDRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRDDIVRWSFRIA
TQTTVGTDVKKDASFKNDSVLKSYETFMKIIVMNVLLPFTHNKIFSTLGGFETQKALAKS
NVNKMIGTIVDKKLMTKPESGSQPEITSVINKAIELHRNGEMSREEVQSECCSFVVAAFE
TTGDTVYHALILLAMFPEHQDTVYQELKELFPVAGDFEVTYDDLQRMVFLERVVNETLRL
IPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSFNPDHFLPDNV
RDRHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKILRNCKVSTSFRYEDLEFVDNIGMEL
AQSPGLEFHRRT*
>313a4 AC017336 153877-155807 also AC007752
MLTWTLWCGLLFLLWIYFLWSRRRFYLLTLKIPGPLGYPILGMAHWLMRREDILNAFGCF
LDKHGPTIFSWLGPIPFMIVSDPQVVQDIFTSPHCVNKGIIYKAVDDGAGVGLFSLKDPR
WSIHRKLLNPAFGHKVLLSFLPIFNRETALLLDQLEPLQDDGEKDLIPLLQSFTLGIATQ
TTMGSDVKDEESFRSNSLLGRYQCILETMTDMCFSPWLNSRFCRQLAGKESHYYQAKTEI
RQFIRKIIERKLAEDEMGALPSIQSNDKNLFLNLVTDLMRRGVFTLKNVEDESNIIVFGA
FETTANAVYYTLMLLAMFPEYQERAFEEIKTIFPNTGDFDVSYADTQQMVYLDLILNESM
RVIPPVPVVSRQTSQDLKLSNGIVVPKGVQIAIDIYHMHRSKKIWGPDAETFNPDHFLPH
NIQDKHPYAYIPFTKGIRNCIGWRYALISAKVTLAKLLRNYRFKTSFPFENLYFVEDITM
KLKSVPLLELQKRT
>313a5 AC017371 6352-8145 also AC007724 rev. 9/8/2000
MLTLQIFEAFAIILCVYFLWSRRRFYIMMLKLPGPMGFPFIGLAFEYIRLKRKIRLRT
ILFKIYGKTVLTWIGLTPVLVTCEPKILEDIFTSPNCSNRSSVVDKAISSCLGLGLLTLK
NNHWNERRKLLLPSFKNNAVLSFVPVLNNEANFLVTLLAEFVDGGDINLLPELNKWSFKI
AAQITMGDEVRNQANYQNGNLLESYKALNNLIPIGVVMPWLRNKYLGKLFSYEKRRLEAA
TQSNAFIKDIIDKKLSSTDNSSEPALIDRILNLVRIGELSYDDVMGEFSNIIFAASDTLS
ITVNNVLILMAMFPKYQDNVFEELAEVFPSGGEFEASHADLEKLVKLDRVLHETMRLIPA
VPLLIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKDIWGPQANAFNPDNFLPENKRAR
PPYSYLPFSKGKKTCLGWKLSLISAKLALAKILRNYMLSTTFLYKDLRFIDNTTMKLAEQ
PLLAVKRRI*
>313b1 AC007571 comp(104264-106046) also AC013225 revised 9/11/2000
MLASIILSGWLLLAWLYFLWSRRRYYKVAWQLRGPIGWPLIGMGLQMMNPESKSWTGFFK
APFISWMGTSCFLYINDPHSVEQILNSTHCTNKGDFYRFMSSAIGDGLFTSSSPRWHKHR
RLINPAFGRQILSNFLPIFNAEAEVLLQKLELEGVQHGKRLEIYQILKKIVLEAACQTTM
GKKMNFQHDGSLCIFKAYNGLTEVCVKRMLSPWLYPDLIYRRSGLFRLQQKVVGILFGFI
EQLLEPIVSVVAANSNPDQQRSEMEMRGKSKAIFIEQVREHVERGQLSWQDVRDEANVTI
AATFETTSTALYFTILCLAMHPCYQEKLHKELVTELPPSGDINLEQLQRLEYTEMVINEA
MRLFAPVPMVLRSADQDIQLKRGDGEFLIPRGTQIGIDIYNMQRDERVWGPLSRTYNPDA
HFGLDSPQRHAFAFVPFTKGLRMCIGYRYAQMLMKLLLARIFRSYRISTEARLEELLVKG
NISLKLKDYPLCRVERR
>314a1 AC012699 22585-24723 also AC006496
MAVILLLALALVLGCYCALHRHKLADIYLRPLLKNTLLEDFYHAELIQPEAPKRRRRGIW
DIPGPKRIPFLGTKWIFLLFFRRYKMTKLHEVYADLNRQYGDIVLEVMPSNVPIVHLYNR
DDLEKVLKYPSKYPFRPPTEIIVMYRQSRPDRYASVGIVNEQGPMWQRLRSSLTSSITSP
RVLQNFLPALNAVCDDFIELLRARRDPDTLVVPNFEELANLMGLEAVCTLMLGRRMGFLA
IDTKQPQKISQLAAAVKQLFISQRDSYYGLGLWKYFPTKTYRDFARAEDLIYDVISEIID
HELEELKKSAACEDDEAAGLRSIFLNILELKDLDIRDKKSAIIDFIAAGIETLANTLLFV
LSSVTGDPGAMPRILSEFCEYRDTNILQDALTNATYTKACIQESYRLRPTAFCLARILEE
DMELSGYSLNAGTVVLCQNMIACHKDSNFQGAKQFTPERWIDPATENFTVNVDNASIVVP
FGVGRRSCPGKRFVEMEVVLLLAKMVLAFDVSFVKPLETEFEFLLAPKTPLSLRLSDRVF
>315a1 AC015141 229-2538 also AC008307 AC007725 AC007648
MTEKRERPGPLRWLRHLLDQLLVRILSLSLFRSRCDPPPLQRFPATELPPAVAAKYVPIP
RVKGLPVVGTLVDLIAAGGATHLHKYIDARHKQYGPIFRERLGGTQDAVFVSSANLMRGV
FQHEGQYPQHPLPDAWTLYNQQHACQRGLFFMEGAEWLHNRRILNRLLLNGNLNWMDVHI
ESCTRRMVDQWKRRTAEAAAIPLAESGEIRSYELPLLEQQLYRWSIEVLCCIMFGTSVLT
CPKIQSSLDYFTQIVHKVFEHSSRLMTFPPRLAQILRLPIWRDFEANVDEVLREGAAIID
HCIRVQEDQRRPHDEALYHRLQAADVPGDMIKRIFVDLVIAAGDTTAFSSQWALFALSKE
PRLQQRLAKERATNDSRLMHGLIKESLRLYPVAPFIGRYLPQDAQLGGHFIEKDTMVLLS
LYTAGRDPSHFEQPERVLPERWCIGETEQVHKSHGSLPFAIGQRSCIGRRVALKQLHSLL
GRCAAQFEMSCLNEMPVDSVLRMVTVPDRTLRLALRPRTE
>316a1 AC017388 35538-37158 also AC010113 AC010557 AC010112
MILTATFICFCLASAFNYFRARRQRSLIKNLKGPFTWPLMGAMHKLLFLTPINFFQRSTE
YLTKYGTFSRCWVFHRLFIPLADLELSRQLLENDTHLETGYELMKDWLVGGVLMCQSEQW
QKRHSLISGLFDKGNLEQLIDLSRHQTEQLLQKLAKQADQKVFDIWYTVSPIVLDLMVMT
TCGAKPSEEYSKNLKDLSEIYRKRFLSLQSANRFNYWLSSPFMRKRQNRLIKRLNDEHNN
LMAMHQSQNQLKIENGLDIYQLRPIPLKDHKSLLEILLESKDPQLTGEEICGELNTCNYL
GYQLCSPALCFCLVTIARNPSVQQKCLDELNLAQIKDQGWDLEKLNYLDAVLHETMRLYP
PQVIVGRQLKKDFPYNAELPCGSEIYINLYELQRNEVRYPKANHFDAQRFLDSPPELLSY
SLGPRCCPARKFSMQLLKTLLAPILANFEVLPYGDEVRLDLRLVLGSSNGFQLALKPR
>317a1 AC020477 126550-128106 no introns also AC009844 AL109349
MWIIFLIIGLLVLGLLVLLIIAARYQRDYWRYLDIPHERPKKLWPIIRQIMTQTLSTEAM
KAEHYSAIYKKFKGSGPFCGFYALLQPRALILDRELIRQIMIKDFWNFNDRGLYCNQKSD
PLSGDLYALRGESWKEMRQKLDPSLEGDRMSLLYDCLYEEAEQLLLTVNSTLMSQPHSTV
HIQKIMRRYVLSSLAKCVFGLNAEQRKTYPLEDFEQMTELALNSHKHGYLMNLMMIRFPN
FCRMLRMRRTPKQAEEYFIKLLTSIVEQRETSGKPQKDYLQLLIDVKALEFITYQYEADK
ELGAHLQNELAAHADVFLKAGYEQTANTLSYVLYELALHPELQVRVREEVKKAIERHDGH
ITHEGIKSLSFMGQVINETLRMHPITPYILRRTLNDYAVPDHPKYILVKELFLIIPTHAI
HHDPDIYPDPEEFKPDRWSGPRDSLQEQGTWFGFGVGARSCIGIQFAQLQLRLALALLLS
EYEFSLNTRKPLINLEDGIALTLMPLGVIEPGNEERAV
>318a1 AC014186 comp(968-207) AA803931 AA803220 AA821188 rev 9/11/2000
MCCLQSTTLDRKKNASWNRSAIVGSDTSDAPEHCPLRCGALLAVLLAWQQRKCWRLIWQL
NGWRGVIQQPVLWLLLCINLHPNSILEKVSQYRVHFQRPLRVLVGTRVLLYIDDPAGMEC
VLNAPECLDKTFLQDGFFVRRGLLHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQ
MVEQFQTQTNLHGQAVKFTAAEDLLSRAVLE
(small gap) AC019897 comp(2937-4007) seq. is incomplete in
Celera AE003488 missing the ETAM exon (about 30 amino acids)
EESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDASNGWQRRIFIEQIFQLAANG
EMTLEEIMDEAQSMVLVVGLKISYLNTIYFIFYCNFQSFETVSNSIMLALLCLATNKGDC
QRRLLAEIRALVPDVGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQ
HETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQ
RDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNFDFQSDFELEKLQFVENISLK
FKNADDILLTIQPKKEST
DOI
Associated Information
Comments
Associated Files
Other Information
Secondary IDs
    Language of Publication
    English
    Additional Languages of Abstract
    Parent Publication
    Publication Type
    Abbreviation
    Title
    ISBN/ISSN
    Data From Reference