Reference Report

Reference
Citation	Whitfield, E. (2002.8.15). FlyBase error report for CG1339. (Export to RIS)
FlyBase ID	FBrf0155338
Publication Type	Personal communication to FlyBase
PubMed ID
PubMed Abstract
Text of Personal Communication	Date: Thu, 15 Aug 2002 15:53:47 \+0100 From: Eleanor Whitfield <eleanor@XXXXXXXXXXXXXXX> To: flybase-updates@XXXXXXXXXXXXXXX Subject: FlyBase error report for CG1339 Error report from Eleanor Whitfield (eleanor@XXXXXXXXXXXXXXX) Gene or accession: CG1339 Release: 3 Gene annotation error Gene CG1339 has incorrect exon/intron structure or translation start site. Comments: new translation (AE003840; AAF59215.3) has 1 amino acid difference to the translation provided by Hugh Robertson. The error is at a splice site so I was wondering if the error it with the reannotation or Hughs original prediction. G43B_DROME LLIAMVLENE-HTSLIIHQKLKPLENMIILDITCDREFVMDYIVTVILTALSLVQYTIST AAF59215 LLIAMVLENEQHTSLIIHQKLKPLENMIILDITCDREFVMDYIVTVILTALSLVQYTIST thanks Eleanor
DOI
Related Publication(s)
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Associated Information
Comments
Associated Files
Other Information
Secondary IDs
Language of Publication	English
Additional Languages of Abstract
Also Published As
Parent Publication
Publication Type
Abbreviation
Title
ISBN/ISSN
Data from Reference
Genes (1)
	CG1339