Home
Reference Report
| Reference | |||
|---|---|---|---|
| Citation | Kovalick, G. (2002.11.6). FlyBase error report for CG30486 on Wed Nov 6 12:47:03 2002. (Export to RIS) | ||
| FlyBase ID | FBrf0155346 | ||
| Publication Type | Personal communication to FlyBase | ||
| PubMed ID | |||
| PubMed Abstract | |||
| Text of Personal Communication |
From: FlyBase-error@XXXXXXXXXXXXXXX
Date: Wed, 6 Nov 2002 12:47:03 \-0800 To: flybase-updates@XXXXXXXXXXXXXXX Cc: kovalick_g@XXXXXXXXXXXXXXX Subject: FlyBase error report for CG30486 on Wed Nov 6 12:47:03 2002 Error report from Gae Kovalick (kovalick_g@XXXXXXXXXXXXXXX) Gene or accession: CG30486 Release: 3 Gene annotation error Gene CG30486 has incorrect exon/intron structure or translation start site. Gene cDNA sequence: >CG30486 tcaattaagctcgcccaattgcagggcattgggattaacatgctcctcgggtgagcagagcccctcatatatggagtgg gttcccgcatagcagcgacttcccggatgagcacttgcccggtagaccagctcattggcgatctttccgcgcgaaaagt gacataggacaccgtactgatagagtccgctcgtttggccttttcgcagcatcatggcacagccgacatgggcagccaa atcttggaccagctgggtgaagtagccgcgacactgtccatccttggccggtttctcggcattgatgtgggccatcgtg cagcccttaacatcatccatccaaaactgcaagacaaagtccaaaacggatatgggatccttctccagttgcaaccact tggtactgccatatatatacgacacatagctgaactcatccgtattgctgcagtaatcgtctatatagtcacaacgcct caaggcaaacttggccaacccggccagttcctcgtgccaccggagtgttgccatccgggaagctggacgcaagtgcgga tactgacccttagccacggtattccgaaaatcgtttaggacggccaggagatgggcacgcatgtgcatgggaaacttca tgatgatcgcttcactgccacaactctcgtcaaagtcgccataattgcggcaagcgatatgcgttatttccggcagaca cagatccttgttgcagtaatccgtagataacgcctcctggctgataaggactattataaggactgaaagaaggtacaac at Protein sequence:>CG30486 MLYLLSVLIIVLISQEALSTDYCNKDLCLPEITHIACRNYGDFDESCGSEAIIMKFPMHMRAHLLAVLNDFRNTVAKGQ YPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVSYIYGSTKWLQLEKDPISVLDFVLQFWMDDVKG CTMAHINAEKPAKDGQCRGYFTQLVQDLAAHVGCAMMLRKGQTSGLYQYGVLCHFSRGKIANELVYRASAHPGSRCYAG THSIYEGLCSPEEHVNPNALQLGELN Comments: CG30486 has sequence similarity to SCP/TPX-1/Ag5/PR-1/Sc (SCP/TAPS) proteins. In vespid wasps, Ag5 proteins have a sequence containing four conserved cysteines in a domain N-terminal to the SCP/TAPS domain. The four conserved cysteines participate in disulfide bonding. A similar domain with four conserved cysteines is also present in some Drosophila proteins with an SCP/TAPS domain. These proteins include Agr, Agr2, CG9400, CG6628, CG8072, CG5106, CG5207, CG10284, CG17210, CG3640, CG9822, CG13569, and CG17575. A sequence with similarity to this N-terminal domain lies upstream of the CG30486 SCP/TAPS domain. The sequence is interrupted by an apparent phase 0 intron. A phase 0 intron with a similar location is present in Agr, CG3640, CG9822, CG17575, CG6628, CG8072, CG5106, CG5207, CG10284, and CG17210. |
||
| DOI | |||
| Related Publication(s) | |||
Recent Updates
|
|||
| Description |
What does this section display?
This section contains items that were added to this record for each release.
It currently only tracks new links between this FlyBase report and other
FlyBase data classes (e.g. genes, references, stocks) or controlled
vocabulary terms (e.g. GO, anatomy terms).
What does this section not display?
This section does not currently display links that were removed or gene model changes.
|
||
| Update Feed |
Click the icon below to subscribe to this FlyBase record and receive updates automatically through your
feed reader.
|
||
| FB2013_03 | |||
| FB2013_02 | |||
| All updates | Click here to see a list of all updates to this record from FB2010_08 and on. | ||
|
Associated Information
|
|||
| Comments | |||
| Associated Files | |||
|
Other Information
|
|||
| Secondary IDs | |||
| Language of Publication | English | ||
| Additional Languages of Abstract | |||
| Also Published As | |||
|
Parent Publication
|
|||
| Publication Type | |||
| Abbreviation | |||
| Title | |||
| ISBN/ISSN | |||
|
Data from Reference
|
|||
| Genes (16)
|
|||