Open Close
Reference
Citation
Saucedo, L. (2002.10.25). FlyBase error report for CG1081 on Thu Oct 24 18:15:50 2002. 
FlyBase ID
FBrf0155349
Publication Type
Personal communication to FlyBase
Abstract
PubMed ID
PubMed Central ID
Text of Personal Communication
From FlyBase-error@XXXX Fri Oct 25  02:26:22  2002
Envelope-to: gm119@XXXX
Delivery-date: Fri, 25 Oct 2002  02:26:22  \+0100
From: FlyBase-error@XXXX
Date: Thu, 24 Oct 2002  18:15:50  \-0700
To: flybase-updates@XXXX
Cc: lsaucedo@XXXX
Subject: FlyBase error report for CG1081 on Thu Oct 24  18:15:50  2002
Content-Length: 2399
Error report from leslie saucedo (lsaucedo@XXXX)
Gene or accession: CG1081
Release: 3
Gene annotation error
Gene CG1081 has incorrect exon/intron structure or translation start site.
Gene cDNA sequence:
>AGAATTACTGTTTTCTTTTACACGATCTGATAAATAATACTGGAATTAAA
ATCGCCGGAAAAGCTCTAGCTGTGATAGAAACACTGGGCCCCAGGAAAAT
GCCAACCAAGGAGCGCCACATAGCCATGATGGGCTACCGATCAGTGGGCA
AATCGTCGCTATGCATACAGTTCGTGGAGGGCCAGTTCGTGGACTCCTAT
GACCCCACCATTGAGAACACCTTCACCAAGATCGAGCGTGTAAAGTCGCA
AGACTACATCGTAAAGCTCATCGACACGGCGGGCCAGGACGAGTACAGCA
TATTCCCGGTGCAGTACAGCATGGATTACCACGGCTACGTCCTGGTGTAC
TCGATAACCAGCCAAAAGTCTTTTGAGGTGGTGAAGATCATATACGAAAA
ACTGCTCGACGTAATGGGCAAGAAATATGTACCTGTGGTGTTGGTCGGCA
ACAAGATCGATCTCCACCAGGAACGAACCGTTTCCACGGAGGAAGGCAAG
AAGCTGGCCGAGTCCTGGCGAGCTGCATTTCTCGAAACGTCCGCCAAACA
GAACGAGTCCGTGGGAGATATATTCCATCAGCTACTGATCCTCATCGAAA
ACGAGAACGGCAATCCCCAGGAGAAGAGCGGTTGTCTTGTATCGTAGGGC
GGCTGAGTAGCTAAAACTACGGCCGAACTGTTGGAAATACGGCAAATCGC
TATGGCAATACGAAAATCGATTATCTCTTATCTACACAGTTGGGTCAGCG
TGCATGGCGGGGCCGTACCCTTTGTGCGCAGCAGGAAAATCTAAAAATCT
AATAGACCTAGTATTCTTAAGACCACACAGCAAGTAACCAATATCAAGCG
ATCTGAATGCGTCCGCTAAACGCTGCCCAGCAGGTTTTGTGGTTCGCGTC
TGGCGCAACACAACAGGTTTAAGTTAGTACGTTTTTTTTACAACAACAAT
TCAGTTACAAATTTCATATACAAATTCTGCAAACTTTTAGTTTCAATTTA
AATATAATTTTTCAAAATACTAAAAAAAAAAAAAAAAAAA
Protein sequence:
>NYCFLLHDLINNTGIKIAGKALAVIETLGPRKMPTKERHIAMMGYRSVGK
SSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEYSI
FPVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGN
KIDLHQERTVSTEEGKKLAESWRAAFLETSAKQNESVGDIFHQLLILIEN
ENGNPQEKSGCLVS
Comments: the aa sequence reported for CG1081 currently reported contains a
different 3' end due to an insertion of 4 bases in the CG1081-RA and CG1081-RB
transcripts.
the corrected sequence that i am submitting is what was formerly reported and
is the ORF predicted from EST GH10361 (the only EST of CG1081 completely
sequenced). My own sequencing of GH10361 and GH14685 agrees with the ORF
predicted for GH10361. Additionally, other partially sequenced ESTs in the
database which cover the 3' end of CG1081 agree with GH10361 and not CG1081-RA
or CG1081-RB.
there is a note saying that 'C-terminus differs from  SWP:Q9VND8  due to
frameshift at last splice site; BDGP EST data is very clear that C terminus is
different.'
DOI
Associated Information
Comments
Associated Files
Other Information
Secondary IDs
    Language of Publication
    English
    Additional Languages of Abstract
    Parent Publication
    Publication Type
    Abbreviation
    Title
    ISBN/ISSN
    Data From Reference
    Genes (1)