Open Close
Reference
Citation
Gronostajski, R. (2003.1.21). FlyBase error report for CG2380 on Mon Jan 20 16:06:59 2003. 
FlyBase ID
FBrf0157254
Publication Type
Personal communication to FlyBase
Abstract
PubMed ID
PubMed Central ID
Text of Personal Communication
From: FlyBase-error@XXXX
Date: Mon, 20 Jan 2003  16:06:59  \-0800
To: flybase-updates@XXXX
Cc: rgron@XXXX
Subject: FlyBase error report for CG2380 on Mon Jan 20  16:06:59  2003
Error report from Richard Gronostajski (rgron@XXXX)
Gene or accession: CG2380
Release: 3
cDNA or EST error
Gene cDNA sequence:
>GATGAATTTCACCCTTTTATTGAGGCACTCTTACCGTACGTCAAATCATTTTCCTACTCTTGGTTTAATTTGCAAGCC
GCCAAACGAAAATATTATAAGAAACATGAAAAACGTATGTCACTGGAAGAAGAAAGACATTGTAAAGATGAACTCCAGA
ATGAAAAGACTGAGGTGAAGCAAAAGTGGGCTTCCCGTCTTCTTGGAAAACTCAGAAAAGACATTACACAAGAAAGTCG
AGAGGATTTTGTGCAATCTATAATCGGGAAAAGAAAATCAATTTGTGTTCTCTCAAACCCCGATCAAAAGGGAAAAATG
AGACGAATTGACTGCTTAAGACAGGCTGACAAAGTATGGCGGCTTGATTTGGTCATGGTTATACTCTTCAAGGCGATTC
CATTAGAAAGCACAGATGGTGAGCGGTTAGAAAAAAATCCGGAATGTTTACATCCAGGATTATGTGTAAATCCGTACCA
CATTAACGTGTCTGTTCGGGAATTGGACTTGTACTTGGCCAACTTTATAAATACTCATAATTCAATTAACAATACAAAT
ACGACTTTCTCAACTACTCCGGGCGTAAGATCGCCACATATAACTATGTATAATCGAAGTAATGATCCAAACAGAAAAG
ATGAGGTCGCTGACATGAAAAATGATGTCGTTAAACAAAACCCATATAATGGTGTTGTTTGTAATGATATTATTTTAGC
AACTGGCGTGTTTTCTTCTCAAGAACTGTGGACATTATCTAAAGATTTAATTTTAGATGAATCAAATGATATAAACCTA
AACTCTAGCCTTATAAAGAGGGAGAACGTTGGAGCTACCTATGAGTGTAATACATATCAAATTAACTCTGAATCCTCAA
TTTCTGCTGCTCAGAGTCTTGTTCAATCTGGGTCAATTGCGGCTAATCCGATTCCACTTGGATATAGCATTGATTTTAT
AGATCAGAGGATTACACAATTATCACAAAGTCCATTGCCAC!
GTACAGAAGGCCCAAACGGCGATTCCCATGATGCTAACAAAATCGATCAAAGTAGCTCACCGCCAATCACGAGCACTG
CATCAGATAATGGCACAAGTAGTTTTTCTTTGATCGTGAGAGCTACGGATAGCTCTATTGAAGATCCAAAAACTTCACC
CATTTCTTTGCATCGCTATACCTCTTTAAGTAGTCGGACGCTGGCCCAAGCTCTCCCACAACATAGTTGCTCCTTGCTA
CATTCGTCTTCCACTAGTCCGACTAATACCTTATATTACCCCCAGCATAATAATACAAGACCATCTCAAACAACTTCCG
TTGAGGAACAAAATCGTGTTGGCTCCGACAAATATTCAACGGAGCCTCAAGATATTTCGGACTTTGTCACTTATGTTTG
TCAAGACACCAGTCATACGACAACTATAACAGGATCAGCTGAAAACCATTCATTTCAACACTCCCATACACTCCCACAA
GGTCATGGTCATTCGCCGCATTTTCAAATTCATCAACAGCTGCGATCTGCAAAATTAACGACTTCACCATCAACTCATT
ATCACAGTACAATGCTTCCGCCGATGCTGCCACCAATGGCTCGACCTGTAGCTATAATTCGCAGTAGCAGTGATCTAAC
CTTAGTCCAATCCCCACCAACTTCTTTGCCACTGACAGCCCAATCTACAAGCTTGAACGACAATAGTTGTATAGCGAAA
CATAGCCTGCCAACGGATAATAGACTTGCAAGTAACCTTGACAACAGAAATAGCCCCAATAACACAGATGTCGTTTCAC
AACACGAAATGACTGGAACTGCATCTCCTCAACCGCAATCTCACACACCGACATTAGCGAGTCCCCAATCTTATCTGGA
TCCTGGGCGATGTAAGCTTTTATCAGCTGGCTCAAACATAGGCAGAATTACAACACAAATGTATCCCTCATCAAATAAT
AGAGAATATTTTAATCACTTTCATTCGCAGCCCACATCGCT!
TTTGGGATATGCCGGCTCTATTTCTACAATGTCTGGAGTTATAAGTCCAACAGACCTAACACTTTACTCA
GCTCCAATGGCTGTATCACGTTCAAGTACCAGGACTAGATGGAACGAAGAGGAGCATAATGTAATTCCACAGTCTGCAT
CTAGTACAAACATGGATAACACCCAAGTTATATTAATGGAAGACTCGACTGGTCGTTATATAGATGAGTATTCTAGTCG
TGACTATGTGTCATGA
Protein sequence:
>DEFHPFIEALLPYVKSFSYSWFNLQAAKRKYYKKHEKRMSLEEERHCKDELQNEKTEVKQKWASRLLGKLRKDITQES
REDFVQSIIGKRKSICVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKAIPLESTDGERLEKNPECLHPGLCVNPY
HINVSVRELDLYLANFINTHNSINNTNTTFSTTPGVRSPHITMYNRSNDPNRKDEVADMKNDVVKQNPYNGVVCNDIIL
ATGVFSSQELWTLSKDLILDESNDINLNSSLIKRENVGATYECNTYQINSESSISAAQSLVQSGSIAANPIPLGYSIDF
IDQRITQLSQSPLPRTEGPNGDSHDANKIDQSSSPPITSTASDNGTSSFSLIVRATDSSIEDPKTSPISLHRYTSLSSR
TLAQALPQHSCSLLHSSSTSPTNTLYYPQHNNTRPSQTTSVEEQNRVGSDKYSTEPQDISDFVTYVCQDTSHTTTITGS
AENHSFQHSHTLPQGHGHSPHFQIHQQLRSAKLTTSPSTHYHSTMLPPMLPPMARPVAIIRSSSDLTLVQSPPTSLPLT
AQSTSLNDNSCIAKHSLPTDNRLASNLDNRNSPNNTDVVSQHEMTGTASPQPQSHTPTLASPQSYLDPGRCKLLSAGSN
IGRITTQMYPSSNNREYFNHFHSQPTSLLGYAGSISTMSGVISPTDLTLYSAPMAVSRSSTRTRWNEEEHNVIPQSASS
TNMDNTQVILMEDSTGRYIDEYSSRDYVS*
Comments: This gene should be marked as the NfI gene in flys. I corrected the
annotation and sent it a few versions of flybase ago. It was probably under
my old e-mail address gronosr@XXXX. We're still missing the first exon,
but I've removed the incorrect synaptogambin sequences from the 5' end that
were in the original predicted gene. I have PCR data for all the sequence
given.
DOI
Associated Information
Comments
Associated Files
Other Information
Secondary IDs
    Language of Publication
    English
    Additional Languages of Abstract
    Parent Publication
    Publication Type
    Abbreviation
    Title
    ISBN/ISSN
    Data From Reference
    Genes (1)