Home
Reference Report
| Reference | |||
|---|---|---|---|
| Citation | Kovalick, G. (2003.2.21). FlyBase error report for CG32679 on Fri Feb 21 11:32:43 2003. (Export to RIS) | ||
| FlyBase ID | FBrf0157257 | ||
| Publication Type | Personal communication to FlyBase | ||
| PubMed ID | |||
| PubMed Abstract | |||
| Text of Personal Communication |
From: FlyBase-error@XXXXXXXXXXXXXXX
Date: Fri, 21 Feb 2003 11:32:43 \-0800 To: flybase-updates@XXXXXXXXXXXXXXX Cc: kovalick_g@XXXXXXXXXXXXXXX Subject: FlyBase error report for CG32679 on Fri Feb 21 11:32:43 2003 Error report from Gae Kovalick (kovalick_g@XXXXXXXXXXXXXXX) Gene or accession: CG32679 Release: 3 Gene annotation error Gene CG32679 has incorrect exon/intron structure or translation start site. Gene cDNA sequence: >CG32679 ttatcccgaccattgattatagttgtacacctcgttgggcgagcagagattcggatagttggagtttcgtcctgtagtg cattccgaggcagcggttcccgccctgtaaaccgggttattcaccacattggtgaccgcgtagttgcaagccagcaggg tggcctgcacattgttggcgtccgtaaatcgagcaatcgcacaacccactcggttatttcgctcgttgaccatggtggt gaagtggccaattgctggtccaccgcgcatctgatagtcctccatgtcgccactggtcgcatcccgattctcatcgaac caggcggcgatccgttggcgcaggaagaccgccacatccacacttcgggtgaagagaatgctcagattctggccggcat agcga tacgtgttcgtgttgcggcattcgtcgtgcgccatgcggcactgcagcgcattgtaggcggccagttgggccagtgtcg tgtcccaggacattgtggccatttggacggcactggggaagccactaactccaccgccagcgatcaggttgcggcgttc gttgtgcagctggagaatcagcgggatgtgggcatccacttggacaaactcgccgctgcaaccgctcacaaagcgaccg ctgttttggcaggccacgtgtcttccactgggacacagttctggatcgcaatagttttgtgcgaaagtaaaagtgaaaa tgataaggaccaaatataaaaggaaaatccagcagggagatcgtgacat Protein sequence: >CG32679 MSRSPCWIFLLYLVLIIFTFTFAQNYCDPELCPSGRHVACQNSGRFVSGCSGEFVQVDAHIPLILQLHNERRNLIAGGG VSGFPSAVQMATMSWDTTLAQ LAAYNALQCRMAHDECRNTNTYRYAGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGPAIGHFTTM VNERNNRVGCAIARFTDANNV QATLLACNYAVTNVVNNPVYRAGTAASECTTGRNSNYPNLCSPNEVYNYNQWSG Comments: CG32679 has sequence similarity to SCP/Tpx-1/Ag5/PR-1/Sc (SCP/TAPS) proteins. In vespid wasps, Ag5 proteins have a sequence containing four conserved cysteines in a domain that is N-terminal to the SCP/TAPS domain. The four conserved cysteines participate in disulfide bonding. A similar domain with four conserved cysteines is also present in many Drosophila SCP/TAPS proteins. These include Agr, Agr2, CG9400, CG6628, and CG5106. A sequence encoding a similar N-terminal domain lies upstream of the CG32679 SCP/TAPS coding sequence. The two sequences are interrupted by an apparent phase 0 intron. A phase 0 intron with a similar location is also present in Agr, CG6628, CG5106 and other SCP/TAPS genes. |
||
| DOI | |||
| Related Publication(s) | |||
Recent Updates
|
|||
| Description |
What does this section display?
This section contains items that were added to this record for each release.
It currently only tracks new links between this FlyBase report and other
FlyBase data classes (e.g. genes, references, stocks) or controlled
vocabulary terms (e.g. GO, anatomy terms).
What does this section not display?
This section does not currently display links that were removed or gene model changes.
|
||
| Update Feed |
Click the icon below to subscribe to this FlyBase record and receive updates automatically through your
feed reader.
|
||
| FB2013_03 | |||
| FB2013_02 | |||
| All updates | Click here to see a list of all updates to this record from FB2010_08 and on. | ||
|
Associated Information
|
|||
| Comments | |||
| Associated Files | |||
|
Other Information
|
|||
| Secondary IDs | |||
| Language of Publication | English | ||
| Additional Languages of Abstract | |||
| Also Published As | |||
|
Parent Publication
|
|||
| Publication Type | |||
| Abbreviation | |||
| Title | |||
| ISBN/ISSN | |||
|
Data from Reference
|
|||
| Genes (6)
|
|||