Open Close
Reference
Citation
Kucharski, R. (2006.3.9). FlyBase error report for CG9935 on Thu Mar 9 00:52:55 2006. 
FlyBase ID
FBrf0191554
Publication Type
Personal communication to FlyBase
Abstract
PubMed ID
PubMed Central ID
Text of Personal Communication
From:  FlyBase-error@XXXX
To:  flybase-updates@XXXX
Cc:  robert.kucharski@XXXX
Subject:  FlyBase error report for CG9935 on Thu Mar  9  00:52:55  2006
Date:  Thu, 9 Mar 2006  00:52:55  \-0500  ( 05:52  GMT)
Error report from Robert Kucharski (robert.kucharski@XXXX)
Gene or accession: CG9935
Gene annotation error
Gene CG9935 has incorrect exon/intron structure.
Comments: There is an error in the annotation of the 3' end of the gene. The
correct structure is:
>FBtr0089102 type=mRNA;
loc= 4:complement (656375..656868,659265..659453,659583..659784,659843..660298<up>..
.</up>)...
Accordingly, the last 3 amino acids of the peptide should be replaced with the
following sequence:
DSVIETYKKIWRSMDNKKPSAFTTTYEDGIKRVNQGNYAFLMESTMLDYIVQRDCNLTQIGGLLDTKGYGIATPKGSPW
RDKISLAILELQERGDIQMLYDKWWKNTDETCTRKNTSKQSKANSLGLESIGGVFVVLIAGIIVAAVVAFFEFWYNFRY
NYEATPSQSVVNNKYNQDGILESERNYTPPDRSFWIEIAEELRYASWCMNKQKRPALTRTCSKCTIPKGQRINKL
There is EST evidence supporting the update.
DOI
Associated Information
Comments
Associated Files
Other Information
Secondary IDs
    Language of Publication
    English
    Additional Languages of Abstract
    Parent Publication
    Publication Type
    Abbreviation
    Title
    ISBN/ISSN
    Data From Reference
    Genes (1)