Home
Reference Report
| Reference | |||
|---|---|---|---|
| Citation | Kucharski, R. (2006.3.12). FlyBase error report for CG8681 on Sun Mar 12 20:10:16 2006. (Export to RIS) | ||
| FlyBase ID | FBrf0191555 | ||
| Publication Type | Personal communication to FlyBase | ||
| PubMed ID | |||
| PubMed Abstract | |||
| Text of Personal Communication |
From: FlyBase-error@XXXXXXXXXXXXXXX
To: flybase-updates@XXXXXXXXXXXXXXX Cc: robert.kucharski@XXXXXXXXXXXXXXX Subject: FlyBase error report for CG8681 on Sun Mar 12 20:10:16 2006 Date: Sun, 12 Mar 2006 20:10:16 \-0500 (Mon, 01:10 GMT) Error report from Robert Kucharski (robert.kucharski@XXXXXXXXXXXXXXX) Gene or accession: CG8681 Gene annotation error Gene CG8681 has incorrect exon/intron structure. Comments: An extra transcript that has a different exon-intron structure at the 3' end should be added: >FBtr0081476 type=mRNA; loc=2L:join(...21197704..21198134,21198406..21198674,21198780..21199411)... Such transcript encodes a full-length ionotropic glutamate receptor, i.e. has the missing C-terminal part of the receptor including the essential TM-4 domain:...NSPYRKQISAAVLKLGELGQLAELKRKWWKEMHGGGNCEKSDEDGGDTPELGLENVGGVFLVLGLGLLSAMVLG CTEFLWNVKSVAIEEKISLKEAFKSEALFAARIWITTKPVHTSSESGSSNSSSSSSSRSKHSFKSQGLSMKSLKSSGYQ DVEASVHSKLKKIGSMFSLKSQKTVTPPPEIGWKLDKSTQIDVVPTSDVDQELIPEVEPHLPHRHHHHHHHRHHHHHHQ PDQEHDRNPSPPE |
||
| DOI | |||
| Related Publication(s) | |||
Recent Updates
|
|||
| Description |
What does this section display?
This section contains items that were added to this record for each release.
It currently only tracks new links between this FlyBase report and other
FlyBase data classes (e.g. genes, references, stocks) or controlled
vocabulary terms (e.g. GO, anatomy terms).
What does this section not display?
This section does not currently display links that were removed or gene model changes.
|
||
| Update Feed |
Click the icon below to subscribe to this FlyBase record and receive updates automatically through your
feed reader.
|
||
| FB2013_03 | |||
| FB2013_02 | |||
| All updates | Click here to see a list of all updates to this record from FB2010_08 and on. | ||
|
Associated Information
|
|||
| Comments | |||
| Associated Files | |||
|
Other Information
|
|||
| Secondary IDs | |||
| Language of Publication | English | ||
| Additional Languages of Abstract | |||
| Also Published As | |||
|
Parent Publication
|
|||
| Publication Type | |||
| Abbreviation | |||
| Title | |||
| ISBN/ISSN | |||
|
Data from Reference
|
|||
| Genes (1)
|
|||