Open Close
Reference
Citation
Caggese, C. (2007.3.27). D. pseudoobscura OXPHOS genes. 
FlyBase ID
FBrf0200156
Publication Type
Personal communication to FlyBase
Abstract
PubMed ID
PubMed Central ID
Text of Personal Communication
From: 	FB_HelpMail_checked@XXXX
Reply-To: 	caggese@XXXX
To: 	flybase-help@XXXX
Subject: 	FB Help Mailer: 122 Gene data (problem or question)
Date: 	Tue, 27 Mar 2007  12:17:47  -0400  ( 17:17  BST)
 comments:    Dear FlyBase,
    We identified and manually annotated the orthologs of the nuclear genes controling oxidative phosphorylation (OXPHOS) in 11 Drosophilidae species.
    The following D. pseudoobscura OXPHOS genes are not yet annotated in FlyBase.
    Yours sincerely
    Corrado Caggese
    UNANNOTATED  GENE:Dpse \CG12203.2; 
    loc=2:(783117..783169,783253..783555,783630..783819);
    Gene product: NADH-UBIQUINONE OXIDOREDUCTASE 18 KDA SUBUNIT;
    NOTE: gene duplicate of Dpse\GA11474 present only in D. pseudoobscura and in D. persimilis. 
    >Dpse\CG12203.2-PA
    MSLLRRVMCRTTATSLQLFTSRCASSKDTDAPLDLNTALARPEDLEKHSK
    LSGTITVPTAVDLSPISGVPSQQLKERRVRIHIPPKNAMQSGTNYLNKWL
    IEFDNRERWENPLMGWASSGDPLSNLNLQFGSKNEAITYCERNGWRWYVD
    KDSDRGQKPKKQRFKSYGVNFSWNKRTRLSTK
    >Dpse\CG12203.2-RA
    ATGTCGCTCCTACGTCGAGTAATGTGCAGGACTACCGCCACCTCCTTGCA
    GTTATTTACTTCCCGCTGCGCGTCTTCTAAAGATACCGATGCTCCACTCG
    ACCTAAATACGGCCTTGGCCCGTCCCGAGGACTTGGAGAAACACAGCAAA
    TTGAGTGGAACGATCACTGTGCCCACAGCCGTAGACCTGAGTCCCATTTC
    AGGTGTGCCCTCGCAGCAGCTGAAGGAGCGTCGTGTGCGCATCCACATAC
    CACCCAAGAATGCCATGCAGAGCGGCACAAACTACCTCAACAAGTGGCTG
    ATTGAGTTCGACAATCGGGAGCGATGGGAGAACCCCCTAATGGGCTGGGC
    CTCCTCTGGCGACCCGTTGTCCAATTTAAATTTGCAGTTCGGATCCAAGA
    ACGAGGCCATCACCTACTGTGAACGCAATGGCTGGCGTTGGTATGTCGAC
    AAAGACAGCGACAGAGGACAAAAACCCAAGAAGCAGCGCTTCAAGAGCTA
    CGGGGTCAACTTTTCCTGGAACAAGCGCACGCGTCTCTCCACCAAGTAG
    //
    UNANNOTATED  GENE:Dpse \CG1970;
    loc=U:(7717544..7717650,7717724..7717848,7717942..7718051,7718402..7718603,7718666..7718853,7718907..7719593).
    Drosophila melanogaster ortholog: Dmel\CG1970.
    Gene product: NADH-UBIQUINONE OXIDOREDUCTASE 49 KDA SUBUNIT.
    Evidences: Comparative analysis with drosophilid orthologs.
    >Dpse\CG1970-PA
    MAFASIVKRSLRSGLQLQGFGLQPPQSSVIGCGLLSSHQHRRAAAKWYPD
    PEFMKQFSGPVMYPDEITSLWKVPPWNSKVTPVEKSVRNLTLNFGPQHPA
    AHGVLRLVLELDGETVMRADPHIGLLHRGTEKLIEYKTYTQALPYFDRLD
    YVSMMCNEQCYSLAVEKLLNIDVPLRAKYIRTLFAEITRILNHIMAVGTH
    ALDVGALTPFFWLFEEREKMMEFYERVSGARMHAAYIRPGGVSLDMPIGL
    MDDIYEFASKFAERLDEVEDVLSTNRIWVQRTEDIGIVTAEEALNYGFSG
    VMLRGSGIKWDLRKQQPYDAYHLVDFDVPIGTKGDCYDRYLCRIEEMRQS
    LRIIDQCLNQMPAGEIKTDDAKVTPPSRSEMKTSMEALIHHFKLFTQGFQ
    VPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAALEKIGK
    QHMLADVVAIIGTLDVVFGEIDR
    >Dpse\CG1970-RA
    ATGGCTTTCGCCAGCATTGTGAAACGTTCTCTGCGCTCCGGGTTGCAGTT
    ACAGGGTTTTGGGTTACAGCCGCCGCAGTCCTCTGTAATAGGATGCGGCT
    TACTAAGTTCGCATCAGCACCGCCGTGCAGCTGCGAAATGGTACCCGGAT
    CCGGAATTCATGAAGCAGTTCAGCGGCCCTGTGATGTATCCCGACGAAAT
    AACTTCGCTCTGGAAAGTGCCCCCATGGAATAGCAAAGTCACGCCCGTCG
    AAAAGTCGGTGCGCAATTTGACACTTAACTTCGGTCCGCAACATCCCGCT
    GCTCACGGAGTACTCCGGCTGGTGCTAGAACTGGACGGCGAGACTGTTAT
    GCGCGCGGACCCACATATCGGATTGCTGCACCGTGGCACGGAGAAGCTTA
    TTGAGTACAAGACGTATACGCAGGCTCTTCCCTATTTTGATCGTTTGGAT
    TATGTTTCGATGATGTGCAACGAACAGTGTTACTCTCTGGCCGTAGAAAA
    GCTACTTAATATTGATGTGCCTCTCCGGGCCAAGTACATACGCACGCTGT
    TTGCTGAAATAACACGCATTCTAAACCACATAATGGCTGTAGGGACACAT
    GCCCTAGACGTTGGCGCACTCACACCGTTCTTTTGGCTCTTCGAGGAGCG
    CGAAAAAATGATGGAGTTTTACGAGCGTGTTTCCGGAGCCCGTATGCACG
    CTGCGTATATTCGACCTGGTGGTGTGTCGTTGGATATGCCGATTGGTTTA
    ATGGACGATATCTATGAGTTTGCCTCAAAATTCGCCGAGCGCCTAGATGA
    AGTGGAGGATGTGCTTAGCACCAACCGCATCTGGGTGCAACGTACTGAGG
    ATATCGGCATTGTAACTGCTGAGGAGGCTCTTAACTATGGCTTCAGTGGC
    GTCATGCTTCGTGGTTCAGGCATCAAATGGGATTTGCGGAAGCAGCAGCC
    ATACGACGCCTATCATCTTGTGGACTTTGACGTGCCGATCGGCACAAAAG
    GAGACTGCTATGATCGCTATCTTTGCCGCATCGAGGAAATGCGTCAGTCC
    CTGCGCATAATCGACCAGTGCCTCAATCAAATGCCTGCAGGAGAAATTAA
    GACGGACGATGCTAAAGTGACGCCTCCGTCGCGTTCCGAAATGAAAACTT
    CTATGGAGGCACTGATTCATCATTTCAAGCTATTTACTCAAGGCTTCCAA
    GTGCCACCTGGCGCCACATATACAGCTATAGAAGCTCCCAAAGGCGAGTT
    CGGTGTTTATTTAGTGTCAGATGGCTCCAGCCGTCCATATCGCTGTAAGA
    TCAAAGCTCCCGGATTTGCCCACTTAGCGGCGTTAGAGAAAATTGGCAAA
    CAGCATATGTTGGCCGATGTCGTTGCCATTATTGGAACATTGGACGTAGT
    TTTTGGCGAAATAGATCGATAG
    //
    UNANNOTATED  GENE:Dpse \CG11423;
    loc= 3:complement (10727852..10729795).
    Drosophila melanogaster ortholog: Dmel\CG11423.
    Gene product: NADH-UBIQUINONE OXIDOREDUCTASE 51 KDA SUBUNIT.
    Evidences: Comparative analysis with drosophilid orthologs.
    NOTE: gene duplicate of Dpse\GA21571 (Dpse\CG9140) present in all 12 Drosophilidae species.
    >Dpse\CG11423-PA
    MIPLGLLRQQLSKNYKISLIRTLADGKGSKGGRNPSGKLHEKPKESADKQ
    QRLKASKFPFVITAPAASKFPVEEEPANRLLEILDSRQGKRKEDLIVNDT
    KKKFDFSRLKPLANFPVESCKNSKSKFPVNERMLETEDDRLEEVLQKAAK
    KVERESRGRLAQNWPAVAQKAKGPAGPPPPPPAKDGPSKRAPPRKAGALP
    PRKLPPGTPPPQTKKTFGPLADADRIFTNLYGRHDWRLKAAMKRGDWYMT
    KEILGKGHLWIINEMKTSGLRGRGGAGFPSGLKWSFMNKPPDGRPKFLLV
    NADEGEPGTCKDREILRHDPHKLVEGCLIAGRAMGANTGYIYIRGEFYNE
    ACNLQYAILEAYKAGFLGPNACGSGFEFDLYVQRGAGAYVCGEETSLIES
    LEGKAGKPRNKPPFPADIGVFGCPSTVTNVETVSVAPTICRRGGNWFASF
    GRTRNSGTKLFNISGHVERPCTVEEELSMPTRELIERHAGGVIGGWDNLL
    AIIPGGSSTPCIPKEDASKAIHDYDGLMAVRSSLGTGAIIVMNKQTDIIK
    AIARLAAFYKHESCGQCTPCREGLHWVNLIMQRFVTGQASIGEIDMLWEI
    TKQIEGHTICALGDGASWPPQGLIRHFRPLIEERIKERAACDAAAAAS
    >Dpse\CG11423-RA
    ATGATACCCTTAGGTCTGCTGCGGCAGCAGCTGTCCAAAAATTACAAGAT
    TTCTCTTATCAGAACCCTGGCGGATGGAAAGGGGTCCAAAGGTGGGAGGA
    ATCCCAGCGGAAAGCTGCACGAAAAACCAAAAGAAAGTGCCGATAAGCAG
    CAGCGACTAAAGGCATCGAAATTTCCATTCGTGATAACCGCTCCAGCGGC
    ATCGAAATTCCCCGTGGAGGAGGAGCCAGCGAACCGCCTGCTCGAAATAC
    TTGACAGCCGCCAGGGAAAACGGAAGGAAGACCTAATCGTCAATGACACG
    AAGAAGAAGTTCGATTTCAGCAGATTGAAGCCCCTCGCCAACTTCCCGGT
    GGAGTCGTGCAAGAATTCCAAAAGCAAGTTTCCCGTCAACGAGAGGATGC
    TGGAGACCGAAGACGACCGACTGGAGGAGGTGCTTCAGAAGGCGGCCAAG
    AAGGTTGAGAGGGAGTCGCGCGGACGCTTGGCTCAGAATTGGCCTGCTGT
    GGCACAAAAAGCAAAGGGTCCAGCAGGCCCTCCTCCTCCTCCTCCAGCCA
    AAGATGGACCCTCCAAAAGGGCACCTCCTCGCAAGGCAGGAGCTCTTCCA
    CCCAGAAAACTCCCACCGGGCACACCGCCGCCACAGACAAAGAAAACATT
    TGGCCCTCTGGCCGATGCTGATCGCATCTTTACCAATCTTTACGGCCGGC
    ACGACTGGCGCCTGAAGGCCGCCATGAAGCGCGGCGACTGGTACATGACC
    AAGGAGATCCTAGGGAAGGGTCATCTGTGGATCATCAACGAGATGAAGAC
    CTCGGGACTGCGCGGCCGCGGCGGTGCCGGCTTCCCGAGCGGCCTAAAGT
    GGTCGTTCATGAATAAGCCACCGGATGGAAGGCCCAAGTTTCTGCTGGTC
    AACGCCGATGAGGGGGAGCCGGGCACCTGCAAGGACCGCGAGATCCTGCG
    CCACGATCCGCACAAGCTGGTGGAGGGCTGCCTGATAGCGGGCCGTGCGA
    TGGGGGCCAACACCGGATACATCTACATCCGCGGGGAGTTCTACAACGAG
    GCCTGCAACCTGCAGTACGCCATCCTGGAGGCTTACAAGGCGGGCTTCCT
    GGGGCCGAACGCCTGCGGTTCCGGTTTCGAGTTCGATCTCTATGTCCAGC
    GGGGAGCGGGCGCCTACGTGTGCGGCGAGGAAACATCGCTCATCGAATCG
    CTTGAGGGGAAGGCGGGCAAGCCGCGCAATAAGCCCCCCTTCCCGGCGGA
    CATCGGGGTATTTGGCTGCCCCTCGACGGTGACCAATGTGGAGACGGTGT
    CGGTGGCTCCTACGATCTGTCGCCGCGGCGGCAACTGGTTCGCCAGCTTC
    GGACGCACCCGCAACTCTGGCACAAAGCTCTTCAACATCTCCGGCCACGT
    GGAGCGGCCTTGCACCGTCGAGGAGGAGTTGTCGATGCCCACGCGTGAGC
    TAATCGAACGCCATGCGGGCGGGGTCATCGGTGGATGGGACAATCTGCTG
    GCCATTATCCCGGGCGGCTCGTCCACTCCCTGCATTCCCAAGGAGGACGC
    CAGCAAGGCCATCCACGACTACGACGGCCTCATGGCCGTGCGCTCCTCCC
    TGGGCACCGGCGCCATCATAGTGATGAACAAGCAGACGGACATCATCAAG
    GCCATAGCCCGTTTGGCCGCCTTCTACAAGCACGAGAGCTGCGGCCAGTG
    CACCCCCTGCCGCGAGGGCCTCCACTGGGTGAATCTGATCATGCAGCGCT
    TCGTGACCGGGCAGGCCAGCATCGGGGAGATCGACATGCTGTGGGAGATC
    ACTAAGCAGATCGAGGGCCACACCATTTGCGCCCTAGGCGACGGGGCATC
    TTGGCCGCCGCAGGGCCTCATCCGTCACTTCCGTCCGCTCATCGAGGAGC
    GCATCAAGGAGCGCGCGGCCTGCGATGCAGCAGCAGCCGCTTCCtaa
    //
    UNANNOTATED  GENE:Dpse \CG40002;
    loc= U:complement (113511..113579,113637..113760,113822..113898).
    Drosophila melanogaster ortholog: Dmel\CG40002.
    Gene product: NADH-UBIQUINONE OXIDOREDUCTASE AGGG SUBUNIT.
    Evidences: Comparative analysis with drosophilid orthologs.
    >Dpse\CG40002-PA
    MSYRLAVFYYARNALGNQILKRGSHVVSYRSAPPEHSKATKIGAVVVGGAMWWWVIWHLW
    HEPDHITGEFDYPTPSEWTNSELGIPKDDA
    >Dpse\CG40002-RA
    ATGTCCTACCGTCTCGCTGTCTTTTATTATGCGCGCAATGCTCTGGGCAATCAAATATTA
    AAAAGAGGTAGTCATGTTGTGTCGTACCGAAGTGCTCCTCCGGAGCATTCAAAGGCAACT
    AAAATCGGAGCTGTAGTCGTTGGTGGAGCAATGTGGTGGTGGGTAATATGGCACTTATGG
    CATGAACCCGATCACATAACGGGAGAATTCGACTACCCTACCCCATCAGAATGGACCAAT
    TCAGAGTTGGGTATTCCAAAAGATGATGCATAA
    //
    UNANNOTATED  GENE:Dpse \CG17054;
    loc=3:(2534487..28553235,2534756..2534842,2535061..2535093);
    Drosophila melanogaster ortholog: Dmel\CG17054;
    Gene product: NADH-UBIQUINONE OXIDOREDUCTASE MWFE SUBUNIT;
    Evidences: Comparative analysis with drosophilid orthologs.
    >Dpse\CG17054-PA
    MWFEILPGAAIITVLLSVPIYAMYGVQKLTLGNAFRRNMDERFSRVMYQRDFRLTDNPYL
    MNGLDAIPDEKKE
    >Dpse\CG17054-RA
    ATGTGGTTCGAAATCCTACCTGGCGCTGCTATTATCACCGTGCTCCTGTCCGTGCCCATA
    TACGCCATGTACGGCGTGCAGAAGCTGACGCTGGGCAATGCCTTCCGTCGCAACATGGAC
    GAGCGTTTCAGCCGTGTGATGTACCAACGCGACTTCCGACTGACCGATAATCCATACTTG
    ATGAATGGCCTCGATGCCATACCAGACGAGAAGAAGGAAtaa
    //
    UNANNOTATED  GENE:Dpse \CG6666;
    loc= 2:complement (28552599..2534585,28553290..28553306);
    Drosophila melanogaster ortholog: Dmel\CG6666;
    Gene product: Succinate dehydrogenase cytochrome b560 subunit.
    CDS: complement(28552725..2534585,28553290..28553292);
     Evidences:DR146991  and comparative analysis with drosophilid orthologs.
    >Dpse\CG6666-PA
    MYALSSTLIRSPALRQGLKMAAVNRQASMKVVSVGSTIKDETYFEKNARLGRELSPHLSI
    YQPQLTSILSVMHRGTGMALGVGVWALGLGALISSHDISHYVTMVEGLQLSGATLTALKF
    IIAYPAGYHTANGIRHLFWDTGRFLKIKEVYSTGYAMVAASFVLTAILALI
    >Dpse\CG6666-RA
    gagaaaaacactgaaATGTATGCACTCTCCAGCACTCTTATTCGATCGCCGGCCTTGCGC
    CAAGGCCTTAAGATGGCCGCTGTCAATCGCCAAGCATCGATGAAAGTTGTCTCCGTCGGC
    TCAACCATTAAGGATGAGACCTACTTCGAGAAGAACGCACGCCTGGGACGCGAGTTGTCG
    CCCCATTTGTCCATTTACCAGCCCCAGCTGACATCCATACTGTCGGTCATGCACCGCGGC
    ACTGGCATGGCTCTGGGCGTTGGCGTTTGGGCCTTGGGTTTAGGCGCTCTGATTTCGTCT
    CACGACATTAGCCATTATGTGACAATGGTGGAGGGACTCCAACTGAGCGGCGCGACATTG
    ACGGCCCTCAAGTTCATCATCGCCTATCCGGCGGGATATCACACTGCGAACGGCATTCGC
    CATCTCTTCTGGGACACGGGTCGTTTCCTCAAGATCAAGGAAGTGTACTCCACTGGTTAT
    GCAATGGTGGCTGCCTCGTTTGTGCTAACTGCTATACTGGCCCTCATCtagacggatgga
    tggatgggatgtctttctccaggacatttggtgcgggtgtgcaagttaaatattagtgtg
    aatatcgtgttataattcattgaatgcattgaatacatgtaaagtatatttatt
    //
    UNANNOTATED  GENE:Dpse \Ucrh;
    loc=2:(25125028..25125111,25125172..25125342);
    Drosophila melanogaster ortholog: Dmel\Ucrh;
    Gene  product:UBIQUINOL-CYTOCHROME  C REDUCTASE COMPLEX 11 KDA PROTEIN;
     Evidences:Comparative  analysis with drosophilid orthologs.
    >Dpse\Ucrh-PA
    MAFRSLFAMPVVKADDEEELVDPQAVLREKCQSKGHIESLYNKYQECNDRVNGRSKTTET
    CMEELFDYVAELDHCVAHSLFSKLK
    >Dpse\Ucrh-RA
    ATGGCCTTTAGAAGTTTGTTTGCAATGCCTGTTGTTAAGGCCGACGATGAAGAGGAGTTG
    GTTGATCCCCAAGCAGTCTTGAGGGAAAAATGCCAATCAAAGGGTCATATCGAGTCCTTG
    TACAATAAATACCAGGAGTGCAATGATCGCGTTAACGGGCGATCCAAGACCACGGAGACG
    TGCATGGAAGAGTTATTTGACTATGTTGCGGAACTGGATCACTGCGTTGCACACAGTCTG
    TTCTCAAAGCTGAAGTAA
    //
    UNANNOTATED  GENE:Dpse \CG4169;
    loc=XR_group8:(2277932..2278069,2278209..2278342,2278416..2278719,2278781..2279693);
    Drosophila melanogaster ortholog: Dmel\CG4169;
    Gene  product:UBIQUINOL-CYTOCHROME  C REDUCTASE COMPLEX CORE PROTEIN 2;
    CDS:(2278025..2278069,2278209..2278342,2278416..2278719,2278781..2279620);
     Evidences:DR138440 , DR154934 and comparative analysis with drosophilid orthologs.
    >Dpse\CG4169-PA
    MACNANKTHLLRAIAKRGYATCPRPVGDISAVSVNVLENKLVVATADATVPVSRVSIVLG
    AGSRNEAYDTLGASHLLRLAGGLSTQNSSAFAIARNIQQVGGTLTTWGDREVVGYTVETT
    ADNVETGLRYLQDLLQPAFKPWELKDNAKTLHNQLDAVTREQRAIELVHKAAFRTGLGNS
    IYIPRFQLGNLSTESLLHYVANTFSASRAAVVGVGIDNNTLSGFAQTLEFPSGGGKTASA
    NYFGGDARKDTTGQRATVAVAGLGGSIANPKEALAFAVLEQAVGAGAATKRGNSSGLFGE
    AANSAGGSRPSSVRALNTSYSDAGLFGFVVSSEAKDIGKTVEFLVRGLKSGSVSEKDVAR
    GKALLKARIISKYSSDGGLIKEIGRQAALSRNVLEADTLIAAIDGITQQQVQEAAKKVAG
    SKLSVGAIGNLENVPYASDLA
    >Dpse\CG4169-RA
    acgatagcggagtaaaaattttcgctctgcgatttttttttaacaaaaactgctttaaaa
    tcagacgaaaaagttagtaatataattaacgcaATGGCCTGCAACGCAAATAAGACGCAT
    CTCTTGCGCGCTATCGCTAAACGGGGCTATGCCACCTGCCCACGCCCCGTTGGCGACATC
    TCCGCCGTCAGTGTGAATGTTCTCGAGAACAAATTGGTTGTGGCCACAGCTGATGCCACC
    GTTCCCGTCTCGCGAGTGTCGATCGTCTTGGGAGCTGGTTCCCGTAACGAGGCCTACGAT
    ACCCTGGGAGCTTCCCATCTGCTCCGCTTGGCCGGAGGATTGAGCACCCAGAACTCGTCT
    GCTTTCGCCATTGCCCGCAACATTCAGCAGGTCGGCGGCACCTTGACCACCTGGGGCGAT
    CGCGAGGTTGTCGGCTACACCGTGGAGACCACAGCCGACAATGTGGAGACCGGTCTGCGC
    TACCTGCAGGATCTGCTGCAGCCAGCCTTCAAGCCATGGGAGTTGAAGGATAATGCGAAG
    ACTCTGCACAACCAACTGGATGCTGTCACCCGAGAGCAACGTGCCATTGAGCTGGTCCAC
    AAGGCTGCCTTCCGTACCGGCCTGGGCAACTCCATCTACATCCCCAGGTTCCAGCTGGGC
    AATCTTTCCACGGAAAGCCTGCTGCACTACGTGGCCAACACCTTTTCGGCCAGTCGCGCT
    GCCGTTGTTGGCGTGGGTATTGACAACAACACTCTGTCGGGCTTCGCCCAGACCCTGGAA
    TTCCCAAGCGGCGGTGGAAAGACTGCATCGGCGAACTACTTTGGTGGCGATGCCCGCAAG
    GACACCACCGGACAACGTGCCACTGTCGCCGTTGCTGGTCTGGGAGGTTCTATTGCCAAC
    CCAAAGGAGGCCCTTGCCTTTGCCGTGCTGGAGCAAGCTGTAGGCGCTGGTGCGGCCACC
    AAGCGTGGAAACTCTTCAGGACTGTTCGGCGAGGCTGCCAACTCTGCTGGCGGCTCGAGG
    CCCAGCTCTGTTAGGGCTCTGAATACCAGCTATTCGGATGCCGGACTCTTTGGCTTCGTT
    GTGTCCAGCGAGGCAAAGGACATTGGCAAGACCGTCGAGTTCCTGGTTCGCGGTTTGAAG
    TCTGGTTCGGTTTCGGAAAAGGATGTGGCCCGTGGCAAGGCCTTGCTGAAGGCCCGCATC
    ATCTCGAAGTATTCCTCCGATGGTGGTCTGATCAAGGAGATCGGCCGCCAAGCGGCGCTC
    AGCAGAAACGTCTTGGAGGCTGACACTTTGATTGCTGCCATTGATGGCATTACCCAGCAG
    CAAGTCCAGGAGGCTGCCAAGAAGGTGGCCGGCTCGAAGCTATCGGTCGGTGCCATTGGC
    AACCTGGAGAACGTGCCCTACGCTTCTGATTTGGCTtaagtagaaaaactcccctgttat
    ccgtaaatgtaacgactaaaaataaacttgttggaattaacgatccgcg
    //
    UNANNOTATED  GENE:Dpse \CG4169.2;
    loc= 2:13982269..13983591 ;
    Gene  product:UBIQUINOL-CYTOCHROME  C REDUCTASE COMPLEX CORE PROTEIN 2;
    NOTE: gene duplicate of Dpse\CG4169 present only in D. pseudoobscura and in D. persimilis. 
    Evidences: Comparative analysis with drosophilid orthologs.
    >Dpse\CG4169.2-PA
    MAYNANKTNLLRAIAKRGLAFCPRPVGDISAVSVKVLENKLVVATADATVPVSRVSIVLG
    AGSRNETYDTLGASHLLRLAGGLSTQNSSAFAIARNIQQVGGTLTAWNDREVVGYTVETT
    ANNVDTGLRYLQDLLQPAFKPWEMMDNAKTLHNQLYAVTQEQRAIELVHKAAFRTGLGNS
    IYIPTFQLDNLSSESLLHYVANTFSASRAAVVGVGIDSSTLSDFAQILEFPNGGGKTASA
    KYFGGDARKETNGQRATVAVAGLGGSIAKHKEALAFAVLEQAVGAGAATKRGNSAGLFGE
    ALNCAGGSSPSSVRALNSTYSDAGLFGFVVSGDAKEIGKTVEFLVRGLKSALVSEKDVAR
    GKAMLKARIISKYSSDGGLIKEIGRQAALSRNVLEADTLLSAIDGITQKQVQVAAKKVAD
    SKLSVGAIGNLQNVPYAADLV
    >Dpse\CG4169.2-RA
    ATGGCCTACAACGCAAATAAGACGAATCTCTTGCGCGCTATCGCTAAGCGGGGCTTAGCC
    TTCTGCCCACGCCCCGTGGGGGACATCTCCGCCGTGAGTGTGAAAGTTTTGGAGAACAAA
    TTGGTTGTGGCCACAGCGGATGCCACCGTGCCCGTCTCGCGCGTATCCATCGTGCTGGGA
    GCTGGTTCCCGCAACGAGACCTACGATACCCTGGGAGCTTCCCATCTGCTCCGCTTGGCC
    GGAGGACTGAGCACCCAGAACTCGTCTGCTTTCGCCATTGCCCGCAACATTCAGCAGGTC
    GGCGGCACCTTGACCGCCTGGAACGACCGCGAAGTTGTCGGCTACACCGTGGAGACCACG
    GCCAACAACGTGGACACCGGTCTGCGCTACCTGCAGGACCTGCTGCAGCCAGCCTTCAAG
    CCATGGGAGATGATGGATAATGCCAAGACTCTGCACAACCAACTGTATGCTGTCACCCAA
    GAGCAGCGCGCCATCGAGCTGGTCCACAAGGCTGCCTTCCGTACCGGCCTGGGCAACTCC
    ATCTACATCCCCACTTTCCAGCTGGACAATCTTTCCTCCGAAAGCCTGCTGCACTACGTG
    GCCAACACCTTTTCGGCCAGTCGGGCTGCCGTTGTTGGCGTTGGTATTGACAGCAGCACT
    CTGTCGGACTTCGCCCAGATCCTGGAGTTCCCGAACGGCGGTGGAAAGACTGCATCCGCC
    AAATATTTTGGGGGCGATGCCCGCAAGGAGACCAACGGACAACGTGCCACTGTCGCCGTT
    GCTGGTCTGGGCGGCTCCATTGCCAAACACAAGGAGGCCCTTGCCTTTGCCGTGCTGGAG
    CAGGCTGTGGGCGCTGGTGCAGCCACTAAGCGCGGAAACTCTGCGGGACTGTTCGGCGAG
    GCTCTCAACTGTGCAGGCGGCTCGAGCCCCAGCTCTGTTAGGGCTCTGAATAGCACCTAT
    TCGGATGCCGGACTCTTTGGCTTTGTGGTGTCCGGCGATGCCAAGGAAATTGGCAAGACC
    GTCGAGTTCCTGGTTCGCGGTTTGAAGTCTGCTTTGGTTTCGGAAAAAGATGTGGCTCGC
    GGCAAGGCCATGCTGAAGGCCCGCATCATCTCGAAGTATTCCTCCGATGGTGGTCTGATT
    AAGGAGATCGGGCGCCAAGCGGCGCTCAGCAGAAACGTTTTGGAGGCTGACACTTTGCTG
    TCCGCCATTGATGGCATTACCCAGAAGCAGGTCCAGGTGGCTGCCAAGAAGGTGGCCGAC
    TCGAAGCTATCGGTCGGCGCCATTGGAAATCTACAGAACGTGCCCTACGCTGCTGATTTG
    GTTTAA
    //
    UNANNOTATED  GENE:Dpse \CG10396.1;
    loc= 2:26847679..26848239 ;
    Putative Drosophila melanogaster ortholog: Dmel\CG10396;
    Gene  product:CYTOCHROME  C OXIDASE POLYPEPTIDE IV;
    NOTE: gene duplicate. 
    Evidences: Comparative analysis with drosophilid orthologs.
    >Dpse\CG10396.1-PA
    MSVMRALGLRLHNQFQQVLPQRGAVMAMMRRGTHHDGTRLMSGDREVVGYGVNGNPIYID
    CVEFPFPAIRYREVTAELCAVREKELGDWKALSIQDKKLLYRHSFCQTYAEFQHFTPDWK
    LVIGVGFWSAAIGLLISLSYYFKLYDPVPETYAEDRRQAQLRRIIQLQMNPITGLSSKWC
    YHTNRWK
    >Dpse\CG10396.1-RA
    ATGTCGGTAATGCGTGCGCTGGGCTTGCGCCTCCATAATCAGTTCCAGCAAGTACTTCCC
    CAGCGGGGGGCGGTAATGGCAATGATGCGTCGTGGGACCCATCACGACGGTACACGCCTG
    ATGAGCGGCGATCGCGAGGTGGTCGGCTACGGCGTGAACGGCAATCCCATCTACATCGAC
    TGCGTGGAGTTTCCGTTTCCGGCGATTCGCTACCGCGAGGTCACAGCCGAGCTGTGCGCA
    GTGCGCGAAAAGGAGCTGGGCGACTGGAAGGCTCTATCGATCCAGGACAAGAAGCTGCTG
    TATCGGCACAGCTTCTGTCAGACCTACGCCGAGTTTCAGCACTTCACGCCCGACTGGAAG
    CTGGTCATTGGCGTTGGCTTTTGGTCAGCCGCCATTGGACTACTGATTTCGCTGTCCTAC
    TACTTCAAGCTTTACGACCCCGTGCCGGAGACGTATGCCGAGGACCGCCGCCAGGCGCAG
    CTGCGCCGCATCATTCAACTGCAGATGAACCCCATTACCGGACTGTCCTCCAAGTGGTGC
    TACCACACCAACAGATGGAAGTAG
    //
    UNANNOTATED  GENE:Dpse \CG10396.2;
    loc= XL_group3b:13703..14257 ;
    Putative Drosophila melanogaster ortholog: Dmel\CG10396;
    Gene  product:CYTOCHROME  C OXIDASE POLYPEPTIDE IV;
    NOTE: gene duplicate. 
    Evidences: Comparative analysis with drosophilid orthologs.
    >Dpse\CG10396.2-PA
    MVTLPMSVMRALSLRLHKQFHQVLPMRAALMAMMRRETHHDGTRLMSGEREVVGYGVNGN
    PIYIDCVEFPFPAIRYREVTPELCAVREKELGNWNALSLQDNKLLYRHSFCQTYAEIQHF
    APDWKLVIGVGLWSAAVGLLISLSYYFKLYDPVPETYAEDRRQSQLRRIIQLQMNPITGL
    SSKWC
    >Dpse\CG10396.2-RA
    ATGGTGACTCTTCCAATGTCAGTAATGCGTGCGCTGAGCTTGCGTCTACATAAGCAGTTC
    CACCAAGTACTTCCCATGCGGGCGGCGTTAATGGCAATGATGCGTCGTGAAACCCATCAC
    GACGGTACACGCCTGATGAGCGGCGAACGCGAAGTGGTCGGCTATGGCGTAAACGGCAAT
    CCCATCTACATCGATTGCGTGGAGTTTCCGTTTCCGGCGATTCGCTATCGCGAGGTCACA
    CCCGAGCTGTGCGCAGTGCGCGAAAAGGAGCTAGGCAACTGGAATGCGTTGTCGCTCCAG
    GACAATAAGCTCCTGTATCGGCACAGCTTCTGTCAGACCTACGCCGAGATTCAGCATTTT
    GCGCCCGACTGGAAGTTGGTCATTGGCGTTGGTCTTTGGTCAGCCGCCGTTGGACTACTT
    ATTTCGTTGTCCTATTACTTCAAGCTTTATGACCCCGTGCCGGAAACGTATGCCGAGGAC
    CGGCGCCAGTCGCAACTGCGTCGCATCATTCAACTGCAGATGAACCCCATTACCGGACTG
    TCGTCCAAGTGGTGCTAA
    //
    UNANNOTATED  GENE:Dpse \CG14235;
    loc=XL_group1e;
    Drosophila melanogaster ortholog: Dmel\CG14235;
    Gene  product:CYTOCHROME  C OXIDASE POLYPEPTIDE VIB;
    Evidences: DR130100 and comparative analysis with drosophilid orthologs.
    >Dpse\CG14235-PA
    MQFFMSKNKNSDKSQDSSNMSAYKLETAPFDPRFPNQNVTRYCYQSYIDFHRCQKKRGED
    FAPCNYFQKVYKTMCPNAWVEKWDDQRESGTFPGRI
    >Dpse\CG14235-PB
    MSAYKLETAPFDPRFPNQNVTRYCYQSYIDFHRCQKKRGEDFAPCNYFQKVYKTMCPNAW
    VEKWDDQRESGTFPGRI
    >Dpse\CG14235-RA
    ATGCAATTTTTCATGTCTAAAAACAAAAATAGCGACAAGTCACAAGACAGCAGCAACATG
    TCGGCCTATAAGCTGGAGACCGCCCCGTTTGATCCACGTTTCCCCAACCAGAACGTGACC
    CGTTACTGCTACCAGTCGTACATCGACTTCCATCGTTGCCAGAAGAAGCGCGGCGAGGAC
    TTTGCACCCTGCAACTATTTCCAGAAGGTCTACAAGACGATGTGCCCCAATGCCTGGGTG
    GAGAAGTGGGACGATCAGCGCGAGAGCGGCACATTCCCTGGCCGCATCtaa
    >Dpse\CG14235-RB
    gttgaaaatttttcgtccaacattcggaacaacaaagcgacaagtcacaagacagcagca
    acATGTCGGCCTATAAGCTGGAGACCGCCCCGTTTGATCCACGTTTCCCCAACCAGAACG
    TGACCCGTTACTGCTACCAGTCGTACATCGACTTCCATCGTTGCCAGAAGAAGCGCGGCG
    AGGACTTTGCACCCTGCAACTATTTCCAGAAGGTCTACAAGACGATGTGCCCCAATGCCT
    GGGTGGAGAAGTGGGACGATCAGCGCGAGAGCGGCACATTCCCTGGCCGCATCtaagccg
    cggtcctgttcccacaatcccagaaagcagaagcagaagcagaggatgaacaccaaccct
    acacgcaaaacagacacagaacagtgcacacgacacgaacaaacaacccaaccagagcag
    agggttgtctccaacgtcccaggatctagcaattgcaacaataatgtcacaccaaactgt
    ttatgattttatttcccggcggtgaaaagcattgacaaaatacaaatacacaattgttca
    attctgtgaa
    //
    UNANNOTATED  GENE:Dpse \CG2968;
    loc=U:(20782828..20782927,20783145..20783349,20783423..20783634,20783701..20783910)
    Drosophila melanogaster ortholog: Dmel\CG2968;
    Gene  product:ATP  SYNTHASE DELTA CHAIN;
    CDS:(20783151..20783349,20783423..20783634,20783701..20783760);
    Evidences: DR153854, DR137378 and comparative analysis with drosophilid orthologs.
    >Dpse\CG2968-PA
    MSFVKNARFLAARGARLAQSRAYSDEMKLTFAAANQTFYDAAVVRQIDVPSFSGAFGILA
    KHVPTLAVLKPGVVQVVDNDGKTTKYFVSSGSVTVNEDSSVQVLAEEAHNVADIDVAEAR
    QLLSKYQSQLSSAGDDKAKAEAAIAVEVAEALVKAAE
    >Dpse\CG2968-RA
    ttgatggtttgacacctctattctgggcaaaaacagcggccgattttcagcaacaaattc
    cattgtattccttttttgccacactccaaatagaaaaaagtgaaatATGTCGTTCGTTAA
    GAATGCCCGTTTCTTGGCCGCACGCGGCGCTCGCCTTGCCCAGTCCCGGGCCTACTCGGA
    TGAGATGAAGCTGACCTTTGCTGCTGCCAACCAGACCTTCTACGATGCCGCCGTGGTCCG
    CCAGATCGATGTTCCCTCCTTCAGCGGAGCCTTCGGCATTCTGGCCAAGCATGTGCCCAC
    ATTGGCTGTGCTGAAGCCAGGTGTTGTCCAGGTTGTGGATAACGATGGTAAGACCACCAA
    ATACTTTGTCTCCAGCGGCTCGGTGACCGTCAACGAGGACTCTTCCGTTCAGGTGCTGGC
    CGAGGAAGCTCACAATGTCGCGGACATTGACGTCGCCGAGGCTAGACAACTGCTGAGCAA
    ATATCAGTCCCAGCTGAGCTCCGCTGGTGACGACAAGGCCAAGGCAGAAGCTGCCATTGC
    CGTCGAAGTCGCTGAGGCGTTAGTCAAAGCTGCCGAAtagacgtaatcacaaccacacac
    aacacccaaaagctaaggcattgcgtttaaagtaaatagatacacaacataactgaattg
    gtggccaatttcaaaagctggctgacatcccacgttatgaaacaataaaaggcgaataat
    aatatcg
    //
    UNANNOTATED  GENE:Dpse \CG6030;
    loc= U:complement (7950763..7951408,7951746..7951788)
    Drosophila melanogaster ortholog: Dmel\CG6030;
    Gene  product:ATP  SYNTHASE D CHAIN;
     CDS:complement (7950860..7951393);
    Evidences: DR140946 and comparative analysis with drosophilid orthologs.
    >Dpse\CG6030-PA
    MAARRITQSSINWSALAERVPANQKTSFGAFKTKSDIYVRAVMANPECPPKIDWAYYKKL
    VPVAGLVDGFQKQYEALTVPYPKDTVSPQVDAQIKESQSEIASYKKVSEQRIQNYQKEIA
    HLKSLLPYDQMTMEDYRDAFPDSALDPINRPTFWPHTPEEQVGYKSKEQIEAEKQGHH
    >Dpse\CG6030-RA
    gttggtgcagaggcatagaaattcttaattctccgtaatttaatatttgtgctacagaAT
    GGCCGCTCGCCGCATCACCCAATCCTCGATAAACTGGTCTGCTCTGGCCGAGCGTGTGCC
    CGCCAACCAGAAGACCAGCTTCGGCGCCTTCAAGACCAAGTCGGACATCTATGTGCGCGC
    CGTGATGGCCAATCCCGAGTGCCCACCAAAGATTGATTGGGCCTACTACAAGAAGCTGGT
    GCCTGTGGCCGGCCTGGTCGATGGCTTCCAGAAGCAGTACGAGGCTCTGACCGTGCCCTA
    TCCCAAGGACACTGTTTCCCCCCAGGTGGACGCCCAGATCAAGGAGTCGCAGTCGGAGAT
    TGCTTCTTACAAGAAGGTCTCGGAGCAGCGCATCCAGAACTACCAGAAGGAGATCGCCCA
    TCTGAAGTCGCTGCTGCCATACGACCAGATGACCATGGAGGACTACCGTGATGCATTCCC
    CGACAGCGCCCTGGACCCCATCAACAGACCAACCTTCTGGCCTCACACCCCCGAGGAGCA
    GGTCGGCTACAAGTCCAAGGAGCAGATCGAGGCCGAGAAACAGGGACACCATtaagtgtc
    actccctcaagcgagaaagcgcctattcgaaatgtaaatgaacatgctaaagcaaattac
    acaaattaaagtcatttcaaatggaattg
    //
 realname: Corrado Caggese
 reply-to: caggese@XXXX
 source: FB Help Mailer:
DOI
Associated Information
Comments
Associated Files
Other Information
Secondary IDs
    Language of Publication
    English
    Additional Languages of Abstract
    Parent Publication
    Publication Type
    Abbreviation
    Title
    ISBN/ISSN
    Data From Reference