Open Close
General Information
Symbol
Dmel\E(bx)-PA
Species
D. melanogaster
Annotation Symbol
CG32346-PA
FlyBase ID
FBpp0072421
Associated gene
Length (aa)
2669
Theoretical pI
8.68
Predicted MW (kDa)
300.7
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSGRGSRKRGRPPKTPNERASGRFNYQLLKKPKYLSEGKSQPSTPSASRGISPQSDEGSRSSHNNHTNRSRGSAAKRGRG
RKSAVQPNTSSYSGRKGYESEYHYGSDFGDSEEDKSDNEDDMLLTPSDDESLEVANESESEFSVCSFNQNGVGRPPRPPS
PEPVWLQEGRQYAALDLPDSSEDLFIANTHVLRALSIYEVLRRFRHMVRLSPFRFEDLCAALACEEQSALLTEVHIMLLK
AILREEDAQGTHFGPLDQKDTVNISLYLIDSITWPEVLRSYVESDKTFDRNVFHILSHTEYPYTGIDNRLEVLQFLSDQF
LTSNSIRDVMLQEGPIHYDDHCRVCHRLGDLLCCETCPAVYHLECVDPPMNDVPTEDWQCGLCRSHKVSGVVDCVLPQEK
QGVLIRHDSLGVDRHGRKYWFIARRIFIEDQENFTCWYYSTTSKLKLLLSRLDAEELETRLHSQITERRDEIERQMKLTE
TLTNEHKHTKRSVIEIEQEAKNELLEKEVLDEDEKDGDAKSESQSIEGTKKQEECKMVTRQKSNQLTNGTLHFKLGMEQG
FKNYVNQYSTNPIALNKPQRNEERDKRRHLSHKFSLTTASDFKWIGITMGTTDNMITTLRQTLINFESNIAASFLNINWV
VNKKIWNAAVMNARRPSEFAVVLLLFQASLKSVVFANVWHEQLGHTTLQRITSAEREERKKLEKREKRERDDEEERNRLA
FNYIKYTLGLKHQVWKQKGEEYRVHGQWGWLWLSSSRRCGVRARRAQPLTHNRVYVHYTMGEENDVNEIILVDPRTQRFM
QQCESSNVDGQVCHYLPDQYKNVKVIEDVTEKIKGHIDVSKALNAPGRTYYSKVARKSRLDDLLDRRLKLAEVEEQMASK
IPSDMKPLLVSSQNNTANSKQTFLEKRLLRLTEVQAKGGPANVNLELVNSLAKQIQTVRLQFSQLNRFAKVFRCYTKECN
TNSNAVSQITQNTCYSPLCLQKARAKKELLLLLRKAHTAGNGSKETVAAILGAVKKPSILEQKLTEGKRESTQVAVDDSE
EGKPAESEAPLDLLQDWEHARAHAVPFSDSLLTECILVDQECVTNTKIKQEVNASSGCNTTPDSNTQDSDKIDYIESMDV
CSNVEIESTEDSIVTGLNSGNAEDVDMTPGWRRKRNQKSKKSYIGTKDVLDQTLDKDIPLNKQNRRFPITARPVKRECVK
KYERETFENGNERVYSTSSPRGRVYLLNDAAKLYEQAVKTEDKSTITKKPSYSRYPLISNFLTHKKKRSLLVLPRFELLK
LARLGGKSSTNGFHHAAKNNTIWQYQCSRPLFRTCWSYRTSNATSLSSLALQLRILWSCLRWDDMIAKPPSTDGKHQVTT
DTEIVTLELLKLRHSGRYGEKTSYLRRKVVIPLEMPKTVREVTSIRSGLRKRKRAESPQPTEPQITEEWVDEDKLELWEI
KFMGEKQEKARLSAVTRSVASRQLEASGSNGSNTSTNGALGVAGRVQLAPKLSEDVKEKMEQQLKLQRAVHQQRKLVATG
EITRSVTPVKGQVIGSRRVIVKNPDGTTRIIQQAVTQVSRTGGANTAAAAASPTVGGSTSTQSNPSTSTPHKVQIIRGPD
GKVSVRGLNPGQQLVQMPDGKLHVLTTTTSSNSAGQGNKMKVPIKPASTSSSPAISSAQTTTNPVTPVIKQIAVKHVTKN
SATQSIASSSRVALPLAQIKNKLLLAQQQQQSTSSSPATSSSPVQKIVSKVVNTSTSGQTLQQVFVQSGSKLVVGQNAQG
QKVIISTSAAQQQGTSPVQQQQLVQSQPIQQSPQQISMTQVGNQPTQKVIQQIVNTSNVQQQIVVGGQRIILSPGQTIVT
QRNVPQSQALQMVQQQIQTQQQQQQHHVVQPQQQFVVQSNQIVQSSPSAQTKLVKQLVVQQQSQQTIEEKTQITTTDSNE
TGTQQVLVPNSTLAQQLAQGKLQVATVNGQQVIVKPLGNNQAQIVAHIKHQGDGNAHIVTSNSATAVPQANPQTSPVKQQ
ALPPQSPQQVVVQQQQIHQQSPTNFESGVTPITQQPVLTQAVQAPAQQQALSVEESLLQNQPPGTVIKCVTAQVLQTEHG
PRIVLQGLVGNDFTAQQLQLVQTQVKQQLMKAQESNGKLGVLGPTKIYLAVQPENAVQSQPPPLTPVHQSAAHQQTNNIE
IDADTLATTYEANSTIKDIAINNGDDQENSKCAETENSNITTNESFAGTSSLLEGSEHDEPTNLAGLDISETDLENKQNE
SFVVTRGYIQKSISNALKQGNLSPELEEKLVCMQKQQENANSTNEWETCSRGSVNEEALTPSRQTDDTEWKIRTSLRRPN
AMTTSSQFNRILKKNRSKNDEVAELGEQKQSQLERHKELLKKNILRKRSLLERNLQSEIHEDVKTKVQRHVRPLSNASPD
EQSENERSGEPNLDFKRTEVQNPRHGAGRPKKLTRKKEKLYCICRTPYDDTKFYVGCDLCSNWFHGDCVSITEEASKKLS
EFICIDCKRARETQQLYCSCRQPYDESQFYICCDKCQDWFHGRCVGILQSEAEFIDEYVCPECQRKNDANAANMKKLTSN
DVEELKNLIKQMQLHKSAWPFMEPVDPKEAPDYYKVIKEPMDLKRMEIKLESNTYTKLSEFIGDMTKIFDNCRYYNPKES
SFYKCAEALESYFVQKIKNFRENVFDQRT
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0072521
9020
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0072522
8960
FBtr0072523
7834
FBtr0301348
8975
FBtr0301349
7362
FBtr0332101
8652
FBtr0332102
9296
FBtr0332103
8605
FBtr0332104
8517
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0072422
2649
FBpp0089425
2159
FBpp0290562
2669
FBpp0290563
2139
FBpp0304411
2163
FBpp0304412
2761
FBpp0304413
2668
FBpp0304414
2669
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG32346-PA
E(bx)-PA
Name Synonyms
Secondary FlyBase IDs
    References (2)