Open Close
General Information
Symbol
Dmel\HDAC6-PB
Species
D. melanogaster
Annotation Symbol
CG6170-PB
FlyBase ID
FBpp0073827
Associated gene
Length (aa)
1135
Theoretical pI
6.45
Predicted MW (kDa)
125.8
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MLRDIWIQSPPIVTRRSAQQAKIQTRAMASKSKTGTTGAATAAGGTGSSSGSISGGFNAADPRKSNKPNAALLEAKRRAR
NNMLKNQGCGSQESVTDIFQNAVNSKSLVRKPTALIYDESMSQHCCLWDKEHYECPERFTRVLERCRELNLTERCLELPS
RSATKDEILRLHTEEHFERLKETSGIRDDERMEELSSRYDSIYIHPSTFELSLLASGSTIELVDHLVAGKAQNGMAIIRP
PGHHAMKAEYNGYCFFNNVALATQHALDVHKLQRILIIDYDVHHGQGTQRFFYNDPRVVYFSIHRFEHGSFWPHLHESDY
HAIGSGAGTGYNFNVPLNATGMTNGDYLAIFQQLLLPVALEFQPELIIVSAGYDAALGCPEGEMEVTPACYPHLLNPLLR
LADARVAVVLEGGYCLDSLAEGAALTLRSLLGDPCPPLVETVPLPRAELAQALLSCIAVHRPHWRCLQLQQTYDCVELQD
RDKEEDLHTVLRHWIGGPPPMDRYPTRDTAIPLPPEKLTSNAARLQVLRAETKLSVPSFKVCYAYDAQMLLHCNLNDTGH
PEQPSRIQHIHKMHDDYGLLKQMKQLSPRAATTDEVCLAHTRAHVNTVRRLLGREPKELHDAAGIYNSVYLHPRTFDCAT
LAAGLVLQAVDSVLRGESRSGICNVRPPGHHAEQDHPHGFCIFNNVAIAAQYAIRDFGLERVLIVDWDVHHGNGTQHIFE
SNPKVLYISLHRYEHGSFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYALAFQQLIMPIAYEFNPQLVLVSAGF
DAAIGDPLGGCKVTAEGYGMLTHWLSALASGRIIVCLEGGYNVNSISYAMTMCTKTLLGDPVPTPQLGATALQKPPTVAF
QSCVESLQQCLQVQRNHWRSLEFVGRRLPRDPVVGENNNEDFLTASLRHLNISNDDATAAAGGLAGDRPDCGDERPSGSK
PKVKVKTLSDYLAENKEALEQSEMFAVYPLKTCPHLRLLRPEEAPRSLDSGAECSVCGSTGENWVCLSCRHVACGRYVNA
HMEQHSVEEQHPLAMSTADLSVWCYACSAYVDHPRLYAYLNPLHEDKFQEPMAWTHGCAWREDGCYATGPDGRDEDDDDD
NGAGSSICLRLERNN
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0074010
3848
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0074008
4483
FBtr0074009
4241
FBtr0301774
3451
FBtr0307383
3817
FBtr0307384
3272
FBtr0330405
4483
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0073825
1128
FBpp0073826
1138
FBpp0290988
883
FBpp0298372
1108
FBpp0298373
1022
FBpp0303431
1179
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG6170-PB
HDAC6-PB
Name Synonyms
Secondary FlyBase IDs
    References (2)