Open Close
General Information
Symbol
Dmel\eIF5-PA
Species
D. melanogaster
Annotation Symbol
CG9177-PA
FlyBase ID
FBpp0073947
Associated gene
Length (aa)
464
Theoretical pI
4.89
Predicted MW (kDa)
51.7
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MATVNVNRSVTDIFYRYKMPRLQAKVEGKGNGIKTVLVNMAEVARAIGRPATYPTKYFGCELGAQTLFDHKNERFVVNGS
HDVNKLQDLLDGFIRKFVLCPECDNPETNLTVSAKNQTISQSCKACGFHGLLKVNHKVNTFIVKNPPSLNPAAQGSSLTE
GKRSRKQKQKNDNADGSMTNNSLANNSGGESDGGNGTNQASQTEAEISAAIPEKTAKDDDDEGWSVDVSKEAIRARLQDL
TDGAKGMTISDDYDKTEKERIDIFYELVKDKRDKKQLDDVQTHKELVIEAERLDIINKAPLVLAELLFTENIIKDVQKNR
PLLLRFTLNNPKAQRYLIGGVEQTVELHKGILMSKVAGIFKLFYDLDILDEAVILEWAQKVSKRHVSKNIAAEIHEKAMP
FVLWLKNAEEESSESEEEEDDESEEDNYVSSAGQRGGQRVVQRGIPRAVAGDEDDEDDVNIDDI
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0074144
2517
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0074145
2588
FBtr0074146
2659
FBtr0074147
2587
FBtr0074148
2358
FBtr0074149
2383
FBtr0074150
2521
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0073948
464
FBpp0089136
464
FBpp0089137
464
FBpp0089138
464
FBpp0089139
464
FBpp0089140
464
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG9177-PA
Name Synonyms
Secondary FlyBase IDs
    References (2)