Open Close
General Information
Symbol
Dmel\kra-PG
Species
D. melanogaster
Annotation Symbol
CG2922-PG
FlyBase ID
FBpp0078394
Associated gene
Length (aa)
422
Theoretical pI
5.46
Predicted MW (kDa)
49.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSQKTERPVLSGQRIKTRKRDEREKYDPTGFRDAVIAGLEKTEGDLEQISKYLDSAGNKLDYRRYGEVLFDILIAGGLLV
PGGSISQDGEKPRTSYCIFDAPESMESMRNHEQVFVKLIRRYKYLEKMFEEEMGKVLLFVKGFTPSERIKLARMTALWLV
NGSVPPNVLLVLNNEHLIKDGIALEFLLELFQTFKQEKGIAYLIQALKKGGLESKLMDFFPPNKRTEEYFKQVFLDKELN
EIVKLHKAQASQEAKRELQQALIDDINDEKPYNEITSDIKDFSQRTNIPDHEIIVIIWSTIMSLGEWNKKEELVTDQAVR
HLKNYCPLLQAFASTDRSELALILKVQEFCYENMNFMKAFQKIILLFYKTEVLSEEIILRWYKEGHSNKGKMHFLEQMRK
FVEWLQSAEEESESEDEQKNGE
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0078745
1614
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0078744
2123
FBtr0078749
1847
FBtr0078746
1906
FBtr0078748
2026
FBtr0078750
1701
FBtr0078747
1776
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0078393
422
FBpp0078398
422
FBpp0078395
422
FBpp0078397
422
FBpp0078399
422
FBpp0078396
422
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (4)
Reported As
Symbol Synonym
CG2922-PG
eIF-5C-PG
exba-PG
kra-PG
Name Synonyms
Secondary FlyBase IDs
    References (2)