Open Close
General Information
Symbol
Dmel\CG2747-PA
Species
D. melanogaster
Annotation Symbol
CG2747-PA
FlyBase ID
FBpp0081308
Associated gene
Length (aa)
2165
Theoretical pI
6.68
Predicted MW (kDa)
236.7
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MENLNFARTPQFLRKVISEARRSFINSDHFSASSTRGRSETEEEAISEMELAHTLILNEDALKQLPEHKRPVFELEWLRY
LEKALPLVSKAEIKASQKKLVQQLSERIQGAPGPPIRKLIASALATLFSVGDTFMLFDTVNACNDILKNKDDSPSYLPTK
LAAICVLGSMYEKLGRMMGRTYEDTVQILIRTLRNAESQARIEIMHTLEKVSAGMGTAIANVHKDIYKAAKHCLLDRVMA
VRVAAARCILKMIYSAPFLYQTELESLGTLCFRAFDGSNYEVRCAVAQLLGTLLAYTQQLAEAATSKKKQGQAVAIQAGK
GATQRLVSLDEALGILMSGFLRGGASFLKGTGEIIKGSSGVNREVRVGVTHAYVVFVQFMGSVWLERQLSTFLAHVLDLV
ANPKAACSHVDAVYSRKCISFILRSTIGKMLGEKAQSAACKELVHLVAKQMNSIDFNPENAKDSNQETLFSQHLLVCALQ
ELSSLLIGLGTTAQNLLGDQSLQAIDATCAVLVHPCAAARLAAAWCLRCACVAVPGQITPLIDRFVEAIEQMRSSPEAMA
GYSCALAAILGSVRYSPLGIPHTKGKVVFNCAEELLRSASQNSRMSLHRTQAGWLLIGAIMTLGSPVVKGLLPRMLLLWR
NSFPRSNKELESEKARGDAFTWQVTLEGRAGALSVMHSFLLNCPDLLNEDITRRLLTPIESALAMLVNLASVLKSYGTQL
KAPAAMVRLRLFETLTLLPANALEASYTHLLRMLVSEFTLSDNAANTTNSLLRTLCHGDDSIILGTWLQETNHRTIEDQM
EPNRKVDGEHLQPNSAAGSGALEHDPCCLYRPRSAQGNGSSSNGSSATSTGGSNGGGGSNIQQISKAQQCPGPLPLGVAV
IDMAVTLYGTIFPKVANKHRLQMLEHFTECIRQAKSSRQEAVQMNIFTALLCALKNLTDSKTSLGQEDVRKSATALIVAS
LTSANSTIRCAAGEALGRLAQVVGDSHFTAELAQNSFDKLKSARDVVTRTGHSHALGCLHRYVGGMGSSQHLSTSVSILL
ALGQDSASPVVQAWSLYALAQIADSGGPMFRGYVEATLTLCLKLLLTVPHAHVDVHQCVGRVVNALITTVGPELQGGGGA
VATMRGSFLCSAALLQSHSDPLVQAEAIGCLQQLHLFASKSLQLEELVPTLVGMLACNYFILRKASVSCLRQLAHREAKE
VCELALTINAEQLPDLVITEYGLPGLLFSLLDTETDAEMLRNIHDTLTSMLQMLAADNLSSWLSLCKNVLTVAVEGGLND
DPAAGEQSKSKEAGGEDDEEDEEEEYADDVTEYRAEENTSTHPAVQPRWPTRVFAAQCVRRIIASCEAASSVHFDLLQAK
EQQLIRSRGDYLILHLAELIRMSFMAATSDSDQLRLEGLRTLQEIIDRFANVPEPEFPGHLLLEQFQAQVGAALRPAFAP
DTPSHVTAAACEVCSAWIGSGVARDIGDLKRVHQLLVSSLDKLSSKTNSTQLYNESMATLEKLSILKAWAEVYIVAMIGN
GKAPASLLNLQSQQSGFQSLTNLETDSDVPDSRGESLLGLVQPELHNLSTHWLSAMKDHALLLLPAEFQSQLPHDGGAFY
TTDTINSSKPHYMTSWPPILYASALWLRDEGFARHLDTSEAAAESNNNQITHGSLSADRFHMIFGICMEALCSMRSSERP
RNIVSCLRSLHSIFDSDWARRQLVKDRALTIELCHVLHRQILTRDELLVQLLCVEILKQTIRAAREDLERKRDDNANSED
GKGGERHGEDDSMQPGSSHVYAVLEVCLCLFVRQIPTMNPTRQGAGGSGLQLDFAYAKMATGSSFFSVLGDENGLLVSSG
LQCVEQLMDLCTPKGALAILPTVLYMTTSIVKEIANKSAIDSTILANTCAVKSALQCLRSVCVHKWAKVEETTEEWQQLL
QSALATIVDLTKTAGDNEERKVDEVTMLLAITVFILHTPASVVATPSLQYPCINHFRQCLQSENLSVKLRCIETTRSIFA
RAELKTATPYIHALAPRIIESLYAESSKVPTSELELQVTLESIVTVEQLIDLSEPQNHIQMLTLLVPVLIGFLAEPSRLR
TLPKYQRQLHDQALQWLLKIGPKYPQEFKALMGQTPELRQKLEAAIRSQQQSINIAQKASEAQRNLLAKPQKPTIKLKTD
FSNFQ
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0081818
7059
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0081817
7049
FBtr0300916
7026
FBtr0300917
7016
FBtr0335229
7289
FBtr0335230
7322
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0081307
2117
FBpp0290138
2154
FBpp0290139
2106
FBpp0307216
2161
FBpp0307217
2172
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG2747-PA
Name Synonyms
Secondary FlyBase IDs
    References (2)