Open Close
General Information
Symbol
Dmel\Pxn-PE
Species
D. melanogaster
Annotation Symbol
CG12002-PE
FlyBase ID
FBpp0089216
Associated gene
Length (aa)
1527
Theoretical pI
6.22
Predicted MW (kDa)
170.5
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MRFMLLMLQLLGLLLLLAGGVQSVYCPAGCTCLERTVRCIRAKLSAVPKLPQDTQTLDLRFNHIEELPANAFSGLAQLTT
LFLNDNELAYLQDGALNGLTALRFVYLNNNRLSRLPATIFQRMPRLEAIFLENNDIWQLPAGLFDNLPRLNRLIMYNNKL
TQLPVDGFNRLNNLKRLRLDGNAIDCNCGVYSLWRRWHLDVQRQLVSISLTCAAPQMLQNQGFSSLGEHHFKCAKPQFLV
APQDAQVAAGEQVELSCEVTGLPRPQITWMHNTQELGLEEQAQAEILPSGSLLIRSADTSDMGIYQCIARNEMGALRSQP
VRLVVNGGNHPLDSPIDARSNQVWADAGTPMHGATPLPSPLPSPPHFTHQPHDQIVALHGSGHVLLDCAASGWPQPDIQW
FVNGRQLLQSTPSLQLQANGSLILLQPNQLSAGTYRCEARNSLGSVQATARIELKELPEILTAPQSQTIKLGKAFVLECD
ADGNPLPTIDWQLNGVPLPGNTPDLQLENENTELVVGAARQEHAGVYRCTAHNENGETSVEATIKVERSQSPPQLAIEPS
NLVAITGTTIELPCQADQPEDGLQISWRHDGRLIDPNVQLAEKYQISGAGSLFVKNVTIPDGGRYECQLKNQFGRASASA
LVTIRNNVDLAPGDRYVRIAFAEAAKEIDLAINNTLDMLFSNRSDKAPPNYGELLRVFRFPTGEARQLARAAEIYERTLV
NIRKHVQEGDNLTMKSEEYEFRDLLSREHLHLVAELSGCMEHREMPNCTDMCFHSRYRSIDGTCNNLQHPTWGASLTAFR
RLAPPIYENGFSMPVGWTKGMLYSGHAKPSARLVSTSLVATKEITPDARITHMVMQWGQFLDHDLDHAIPSVSSESWDGI
DCKKSCEMAPPCYPIEVPPNDPRVRNRRCIDVVRSSAICGSGMTSLFFDSVQHREQINQLTSYIDASQVYGYSTAFAQEL
RNLTSQEGLLRVGVHFPRQKDMLPFAAPQDGMDCRRNLDENTMSCFVSGDIRVNEQVGLLAMHTIWMREHNRIASKLKQI
NSHWDGDTLYQEARKIVGAQMQHITFKQWLPLIIGESGMEMMGEYQGYNPQLNPSIANEFATAALRFGHTIINPILHRLN
ETFQPIPQGHLLLHKAFFAPWRLAYEGGVDPLMRGFLAVPAKLKTPDQNLNTELTEKLFQTAHAVALDLAAINIQRGRDH
GMPGYNVYRKLCNLTVAQDFEDLAGEISSAEIRQKMKELYGHPDNVDVWLGGILEDQVEGGKVGPLFQCLLVEQFRRLRD
GDRLYYENPGVFSPEQLTQIKQANFGRVLCDVGDNFDQVTENVFILAKHQGGYKKCEDIIGINLYLWQECGRCNSPPAIF
DSYIPQTYTKRSNRQKRDLGKENDEVATAESYDSPLESLYDVNEERVSGLEELIGSFQKELKKLHKKLRKLEDSCNSADS
EPVAQVVQLAAAPPQLVSKPKRSHCVDDKGTTRLNNEVWSPDVCTKCNCFHGQVNCLRERCGEVSCPPGVDPLTPPEACC
PHCPMVK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0072954
4820
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0072951
5126
FBtr0072950
2492
FBtr0072952
5184
FBtr0072953
5196
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0072828
1527
FBpp0072827
457
FBpp0089205
1527
FBpp0089215
1527
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG12002-PE
Name Synonyms
Secondary FlyBase IDs
    References (2)