Open Close
General Information
Symbol
Dmel\f-cup-PE
Species
D. melanogaster
Annotation Symbol
CG9611-PE
FlyBase ID
FBpp0111852
Associated gene
Length (aa)
620
Theoretical pI
4.97
Predicted MW (kDa)
70.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MCGPYPRRRRYYQIREFQMASSADELESEDPDDELELDDSEPPTRAEDLPKRLYDINEADADSKAVNLEQLTIKEEDAWW
NQVPLNNLDLSSNTLTHISPKIENLQSLTVLTLHDNALVELPPEIGKLEKLVRLNVSHNKLSQLPRAMYSLPELRHLNIS
YNEFVELNPDISDLHMLEFLDGGHNNIQSLPGGIGFLVRLTALLLPYNHIKELPPDLVNMRSLQKIDLMHNDLTSLPEDM
GLLRKLDCLYLQHNDILELPEFEGNEALNELHASNNFIKIIPKAMCSNLPHLKILDLRDNKITELPDELCLLRNLNRLDV
SNNTISVLPVTLSSLAHLISLQVEGNPIKTIRRDILQCGTTRILKTLHDRAVAKAKEEGGGVDDASTSAGISVTRLRGGQ
MDDGDIPGNFPDRYKLRHTRTLAVNLEELTSVPDQVFQIARDEGVHVVDFARNQLSTLPNGLQHMKDLVTELVLSNNVIG
YVPQFISQFTRISFLNLSNNLLNDLPTEFGVLNTLRELNIANNRFPCIPNCVYELQGLEILIASENHIKMLNVSGLQNMR
RLSTLDLRNNDIETVPPILGNLTNITHLELVGNPFRQPRHQILMKGTDAIMSYLRDRIPT
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0112939
2219
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0082846
2558
FBtr0082847
2470
FBtr0112937
3407
FBtr0112938
2532
FBtr0334526
2885
FBtr0334527
2797
FBtr0334528
2795
FBtr0334529
3319
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0082311
693
FBpp0082312
650
FBpp0111850
522
FBpp0111851
474
FBpp0306593
802
FBpp0306594
759
FBpp0306595
571
FBpp0306596
522
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG9611-PE
f-cup-PE
Name Synonyms
Secondary FlyBase IDs
    References (0)