Open Close
General Information
Symbol
Dmel\CG13481-PB
Species
D. melanogaster
Annotation Symbol
CG13481-PB
FlyBase ID
FBpp0112083
Associated gene
Length (aa)
176
Theoretical pI
10.43
Predicted MW (kDa)
20.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSSNSSESLNKMKSLVGKMIFMQVTEHLFLRAQQLLDSDVSIEERVRRMEVLNNNMKWFNSERTRILEQLQLNIFGQISV
EHHNAMNMSENLYELREGLDGLSRRMESMQEDITCSICLSPWSSNGRHRVVSLRCGHLFGNSCIRTAIRRSHRCPICRRR
ALHADVRRIFSRRISH
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0113170
714
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0333022
783
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0305236
176
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG13481-PB
Name Synonyms
Secondary FlyBase IDs
    References (0)