Open Close
General Information
Symbol
Dmel\wech-PE
Species
D. melanogaster
Annotation Symbol
CG42396-PE
FlyBase ID
FBpp0289361
Associated gene
Length (aa)
832
Theoretical pI
6.46
Predicted MW (kDa)
90.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MMELLSNNSVPQQMASSNAPSANNVAHSSTANGSGGGSVSSNASNSSERLLAGILESFPAWDLNVGLLPNVGQSSPPRAD
FFINNFLGGLDTHGDFSIGPIGSGARSNPKMSPESSNNSSISCGWCEVSASIRCLECNEFMCNDCLREHRNSPLSSNHSI
VSLPTPIGASPTGGSSVNAQTPPSGNFICDIHNEMLRYVCDYCRKLVCQCCTLHEHKEHSYASIQSFMVGSKEKLEGAIE
SSQVGTRCIKSSIDKALAFIRLIERNCSELSDNIRKAFRQFIIAIEDRERFLLDFVEKLRQRRLAILHDQMAGLKSALAG
LSETSDMLSKVADNACNMDQIEIAMKLTNGQRQMEQFAGIYKDLQPKQEVFAFAPPDYSLLQDIRNQGGVILVDDKNLPI
VSSSNGIVPSVSSVNAVAAASVGVVGGVAGVVGGVGVSNGLDLAFGMNMPNNPLSVASSSVRRPLLRDNSFRIPSPIMQP
RGGSACGMSSGMSSAALDWELNGLRSSPGLHFSAPRTTQAIPGCMDLVKVRNSNALSLSFATEGHEDGQVSRPWGLCVDK
MGHVLVSDRRNNRVQVFNPDGSLKFKFGRKGVGNGEFDLPAGICVDVDNRIIVVDKDNHRVQIFTASGVFLLKFGSYGKE
YGQFQYPWDVAVNSRRQIVVTDSRNHRIQQFDSEGRFIRQIVFDNHGQTKGIASPRGVCYTPTGNIIVSDFDNHCLYLID
PDINDILSVKGHEGSGFHEFNRPSGLCCDDEGRIIVADSKNQRILVFNQNLDFMWDIEVRPSINPLMPPTLDEKDRTCDV
AIMPDGRIVFLIELSPDSKEGSNPYKRFVHVF
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0300084
4316
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0300080
4495
FBtr0300081
3290
FBtr0300082
7593
FBtr0300083
6021
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0289357
832
FBpp0289358
832
FBpp0289359
832
FBpp0289360
832
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG42396-PE
wech-PE
Name Synonyms
Secondary FlyBase IDs
    References (0)