Open Close
General Information
Symbol
Dmel\gol-PC
Species
D. melanogaster
Annotation Symbol
CG2679-PC
FlyBase ID
FBpp0289415
Associated gene
Length (aa)
461
Theoretical pI
8.61
Predicted MW (kDa)
51.8
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MYIRKTLLLACLVLLFGGLPPLTFPATTTTLVAAMSIANQDLERYFRPGNGTHSFSGMEDRIAVDVYNYAFLNWSYVEHG
NMLCNMEFAQEQARYGEGKVLNVTGRLIHITATDNFSDDYACTPYIRGTLGAPIPDKGETWIALVRRGRCTFEEKVKHVY
QQNAAGVIIYNDKQVMQLEKMQIKGKTRNIAAVITYQNIGQDLSLTLDKGYNVTISIIEGRRGVRTISSLNRTSVLFVSI
SFIVLMIISLVWLIFYYIQRFRYMQAKDQQSRNLCSVTKKAIMKIPTKTGKFSDEKDLDSDCCAICIEAYKPTDTIRILP
CKHEFHKNCIDPWLIEHRTCPMCKLDVLKFYGYVVGDQIYQTPSPQHTAPIASIEEVPVIVVAVPHGPQPLQPLQASNMS
SFAPSHYFQSSRSPSSSVQQQLAPLTYQPHPQQAASERGRRNSAPATMPHAITASHQVTDV
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0300178
3193
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0072459
2583
FBtr0300179
2520
FBtr0306330
3725
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0072361
461
FBpp0289416
601
FBpp0297426
461
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
gol-PC
Name Synonyms
Secondary FlyBase IDs
    References (0)