Open Close
General Information
Symbol
Dmel\Kcmf1-PE
Species
D. melanogaster
Annotation Symbol
CG11984-PE
FlyBase ID
FBpp0289968
Associated gene
Length (aa)
599
Theoretical pI
5.48
Predicted MW (kDa)
62.4
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSRHEGVSCDSCLKSNFNGRRYKCLICYDYDLCADCYEDGVTSTRHLVEHPMQCILTRSDIELYFGGEMLASDQPQSFTC
PYCKKMGFSDATLLEHVSAEHTETSLEVVCPVCAGLPGGEPNLVTDDFAGHLTLEHRQGPRELISFLDEPSAIRHGGGVR
RIPGRTLGGPRTRRSNMHFSSSSGLSALSPSGRESVDPIAELLSQLSGVRRGGPPTSQLQQLQMQMQLDRQQVTASRQID
RLPRRAHPIVSTSNSNAAMAEVISGGAGGSGGSGAVGSGSGGGSGATAPPNLRTTEWPVTASFSTSASNHSQTQSSLAAN
SLNAREAIGTSSSAGSNVLGISVGVGGTANGNGGAGSSGVATGAGGAGQGGGQGGAAAGESFLLAQFMQPTFTEAEWAVV
ESMRADRSMFVQSLMLSMLCTEALDLNASDESLAKSDNVNKGQQQQQEDAEAEAQAETLLNNNADVEQQQQQQQLQPAMV
RQVNQMQQTSPEDFVCDEYRYKNKKANTTQTSGTGGLGGAGATAAPGGGASGAGTKPTADRGIERRSGRPPPGEMATGSQ
QPQQQQQSTANPAASQQKYKQNASAATAAGNTNQIPDTR
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0300744
2481
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0300743
2394
FBtr0300745
2417
FBtr0300746
2488
FBtr0300747
2445
FBtr0300748
2545
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0289967
599
FBpp0289969
599
FBpp0289970
599
FBpp0289971
599
FBpp0289972
599
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG11984-PE
Kcmf1-PE
Name Synonyms
Secondary FlyBase IDs
    References (0)