Open Close
General Information
Symbol
Dmel\Not1-PF
Species
D. melanogaster
Annotation Symbol
CG34407-PF
FlyBase ID
FBpp0291332
Associated gene
Length (aa)
2492
Theoretical pI
6.80
Predicted MW (kDa)
279.9
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MNVESQLKTPPTHIRNLVKHVNKRNFNESSEQINQFVKEHGLEADRSSLRHLFSVINFSDLVPSVTVQLQAKLLGIQLER
QLHSSSFVSNICYAFDQFFASNQKSLKPVAVADLVGQVARLTGINKVCECVFALALTHSSYTELKHSARNNLKGSLSELI
DSYLGNKGTGPADSGLREISFDLLQYLLCCLSEYVQPQVEAQFLIKLREEFPRQAVPLVLAPFLYGSTTATIAGAGASET
DAEAEATTNSNSSSFEADALNEVGIEDIYDHLSEIIFTNQGKNNIMDTSWINLILEIGYEFTSSVEECKNHLCSRERERA
ELQSKDVAKIVGLMCRRHSSLLDCNVNLPTPANFWPGQGQGGGSNSSGSSQTQITPQQQNPGSSNNNDGSDGNSSSDKKD
KKETTEATQTWKPDVFVQALKEVVPQLNWKDVCMELDHPEFVLKDRIGLELLLTILRLATGSNIFPHPECIYRHWANTEG
QLSLIATMLKNPDLFSFADFVFSQPALDVLKTAPDADNKEISSWKSLHLVEVLLSIADKGYYTQVHELFKFPAQNCPDVL
FLALLNTSPPMTPLRQDLFNQLIPTFLGNHPNSNVILASAWSSNNFQLRSNIMNAMSEWYLRGNEFDQVKLSRILDLAQD
LKALSALLNARSFLFIIDLACLASRREYLKLEKWLTDKIREHGEPFMQAIIKVLHRRCPQVINAKVPEDQLPPKQAQLLP
ETVTTMINCLQTCINNCMQPEMVEVIMQMTANVAIMANKARAQQQQQPGLVPPPPPTILRGHRGMDLPGGIVPPPPQQPF
SGNLNAQMFGPGMDPLTNMSNNLAGLNLSGPNGAFNFGNMLTSPSRLMTPGANPYPLNLMQMPQAPPPPNVGNLGRMLPG
GPQQQTPTPTPTAPNPNNPVMADLQIPVSKEVEDEVNSYFQRIYNHQPNPTLSIDEVLDILQRFKESSNRREQEVFLCML
RNLFEEYRFFCQYPEKELQITAQLFGGIIDRNLVPTFVALGLSLRCVLDALRKPDGSKLYYFGVTALDRFRTRLHTYNKY
CEHIRSIPHFSDFPPHLIQYVEYGMHGQEPPPQKLIGLSNTIPSAISSGPGTEPIYRNSSMLGNMPAATPGSGPKSNAAV
SHATRMKSIANATNIDTLLVANQEEKVTVPPEPVQDKTAFIFNNLSQLNIPQKCDEIKEIMTKEYWPWLAQYLVLKRASM
EFNFHTLYYNFLDALKNGEINRFVTKETLRNIKVLLRSDKGVINFSDRSLLKNLGHWLGMMTLGRNRPILQLDLDLKSLL
AEAYHKGQQELLFVVPFVAKILESSAKSRIFRSPNPWTMGIMYVLAELHQEPDLKLNLKFEIEVLCKTLNLELAKLRQVI
YLKDPNRTHRIEEQMSQPKPKQLEPVASAPALPREQQSPAQPPPPPQQQQPPQQQVPPPPSSADVDAQNAAAMMMAAGGA
NSTPGSVSSPNLPTDSSQVALPPPEPRYSYVDVNVSNFQLIGQQLVLPPNTPFLHANPGIKHMVVNAVERTITDWLQPIV
DRSIRIACATTEQIIRKDFALDADENRMRTAAHQMVRNLAAGMAMITGKDEIARAISQNLHKALLSGLNGMPSMAEIQAA
AMQLASENVELVCAFIQKTSAEKAAAEIDRRLSTDFETRKIAREEGNRFVDAQILTYQQERLPEAVRIKVGAAPATLYAV
YSEFARSIPGFQQMSDRDIALFVPKPTDLSQPNVFANDDSMVYGELASKMEAFMNTAIGVPTLQIQASKMHMLLNALIAT
RRLRDQESAFNLLTRAVEGLTEGLVNMHENMEQMKMYQNIHLRILGLLNNSFGAPNTERAVTKCFFDIREEVRYNVEAAR
ALITSHFVNLNQFDGMLRDCMDNGNNYVAISFGIALLERLIMDDRVINIVSDNEFMATVELLGRLTQHRHRYPECIVNAI
DTLWSGNFNSSSDYSPFNGNDRYLSGASHYIHSGMHHVRSCDTDDPPGLQEKTEFLLKDWVALYTQQNQQSTRDARNFGA
FVQKMNTYGILKTDDLITRFFRQATHICTDVVYRMFAEPSLPINQAKNKIFQWIDAFVHLIAMLVRHSGEAGNPTTKINL
LNKVLGIVLGTLIKDHEMRGVSFQQVGYHRFFMMLFMELCTADVILESLMHSIVSAFAYTYHLLNPSVAPGFCFAWLELI
SHRVFLGRILVQIPGQKGWPLYAQLLQDLFKYLAPFLRNTELGKPVQLLYKGTLRVLLVLLHDFPEFLCDYHFGFCDTIP
PNCVQMRNIILSAFPRNMRLPDPFTPNLKVDMLSDSSNAPKVLSSYIMNIQPANFKKDLDSYLKARAPVTFLSELRGHLQ
VTSEPGTRYNMALMNALVMYVGTQAIALIRNKNFVPNTSNIAHSAHMDIFQNLAVDLDTEGRYLFLNAIANQLRYPNSHT
HYFSCAVLHLFAEANSEAIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPIYKFWDHDFVHCAPEITKYFGECLIVVK
RFENSIGIQCAS
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0302122
8340
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0112672
8700
FBtr0112673
8694
FBtr0112674
8201
FBtr0304957
10068
FBtr0339394
8191
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0111584
2505
FBpp0111585
2503
FBpp0111586
2220
FBpp0293496
2505
FBpp0308486
2511
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
Not1-PF
Name Synonyms
Secondary FlyBase IDs
    References (0)