Open Close
General Information
Symbol
Dmel\CG42672-PJ
Species
D. melanogaster
Annotation Symbol
CG42672-PJ
FlyBase ID
FBpp0291846
Associated gene
Length (aa)
1500
Theoretical pI
8.05
Predicted MW (kDa)
165.9
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MFKSRLKTNPGGSENINRFGDSMGSLGHRALLQYIDNNDISGLRAILDSRHLTIDDRDENATTVLMVVAGRGLTAFVREF
LARGADVQAEDLDNWTALLCASRNGHLDVVQLLLDHGAEVEHRDMGGWTSLMWAAYRGHTELVRLLLDKGADGNAHGNYH
LGALLWAAGRGYKDIVELLVQRGAKVNVGDKYGTTALVWACRRGNVEIVDTLLKAGANVDTAGMYSWTPLLVAAAGGHTD
CVSSILEKKPNVNALDKDGMTALCIASREGFQDIAASLIAAGAYINIQDRGADTPLIHAVKAGHRTVVEALLKKHADVDI
QGKDRKTAIYTAVEKGHTPIVKLLLATNPDLESATKDGDTPLLRAVRNRNLEIVHLLLDRKAKVTASDKRGDTCLHIAMR
ARSKTIVEALLRNPKHSQLLYRANKAGETPYNIDSLHQKTILGQVFGARRLNTNEDSEGMLGYELYSSALADVLSEPTLT
TPITVGLYAKWGSGKSFLLNKLRDEMNNFARQWAEPPIRTSGLLFIVCLHVALLIGTIVGLSTWSAVVGVSAAVGFLLLA
YLLLAAVRYCNYQMDMQWAYSVQHGLEKRMTRLRLILQVAFCHPPGPQSDSQAKPVRFHFAEANSASPTGDGAVAHMLAA
LLDAIESHYGWLATRLYRAFRPKCLKVDVGWRWRRMCCIPIVLIFELALVTVVTGISLTVAYFTFADEKEKEHILVALYV
IAAVMGTLICTHLHVLAKVFVSLFTSHIRVLKRAVRSSESAPLTMLGAEVAVMTDMVKCLDAFTNQQSRLVGVIDALDSC
DTERILTLLNAVQTLLSSPNRPFVLLISVDPHVIAKAAEANSRRLFTEGGIGGHDFLRNLVHLPVYLQNSGLRKVQRAQM
TALLFKRSGGGDYQTDDGPTLGHSVSARRLSNASEIISSQEKLRGPARGGGGKKLRLSESVASSTGSNLHRLGQNPQTVL
DLSRIVLTDDYFSDVNPRSMRRLMNVIYITVRLLKAFQIEFSWYRLSSWINLTEQWPLRASMIVLHHDQFMDSNADESVS
LQSVYEKLRPKLAYLREAAPLLELDRDERKLDAFLQLHKSDLLVADLRIFLPFTINLDPYLRKVLKEDQQTIEDEGSLVI
QARPSVSNTMRQFPAPTTYVPSPQAYPPYQMFQNEYPANELRSRNLSTSTEPVTPLINSPSDSFGDDILQTKLTDLTVEG
VISLLDRIEDMKPALPKLAPVLRENAINGRVLKHCDMPDLKSVLGLSFGHWELFRLLITTLRECERLPRKQQRQQQQPGA
LEAPSNVPMIKDVTDALMQPPRESLSRKNSVSHMEKQVTLEEQMICGTLQTLNEEAYEDVASSERPSPTELDTPSAGAAM
TTPLLGASGSVPAPSGRESILKQQGSVKADKRVSIQQMATSNNNNNNSTKLTPNVEYVSERQPEVQGAGKRLTTKPPPGP
RPASLIITRNDSNSQFQLLRSSSVDYDDVEAQEHRTTIRTTLLEQQEEEESAPFVFTVRK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0302706
4908
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0302701
5291
FBtr0302703
5356
FBtr0302704
5071
FBtr0342885
5321
FBtr0342886
5273
FBtr0302702
5454
FBtr0302707
5193
FBtr0344188
5989
FBtr0344189
5826
FBtr0479847
4825
FBtr0479848
4988
FBtr0479849
5088
FBtr0479850
5251
FBtr0479851
5303
FBtr0479852
5436
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0291841
1478
FBpp0291843
1550
FBpp0291844
1498
FBpp0309686
1488
FBpp0309687
1518
FBpp0291842
1476
FBpp0291847
1552
FBpp0310600
1640
FBpp0310601
1642
FBpp0428183
1518
FBpp0428184
1516
FBpp0428185
1493
FBpp0428186
1491
FBpp0428187
1528
FBpp0428188
1516
External Crossreferences and Linkouts ( 5 )
Crossreferences
FlyMine - An integrated database for Drosophila genomics
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
modMine - A data warehouse for the modENCODE project
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG42672-PJ
Name Synonyms
Secondary FlyBase IDs
    References (0)