Open Close
Reference
Citation
Curtis, D. (2002.3.19). Helping FlyBase: ADRC-10907. 
FlyBase ID
FBrf0146797
Publication Type
Personal communication to FlyBase
Abstract
PubMed ID
PubMed Central ID
Text of Personal Communication
From rd120@XXXX Mon Mar 18  09:38:44  2002
To: curtis@XXXX
Subject: Helping FlyBase: ADRC-10907
Dear Daniel,
We are currently curating the abstracts for the upcoming 43rd
(San Diego) Annual Drosophila Research Conference, for FlyBase.
I am writing in connection with your abstract:
'New Genes Required for Presenilin Function.'
You mention genes that are new to FlyBase, pen-1 and pen-2. Do you
know which of the Genome Project CG annotations your genes correspond
to? All the CGs have corresponding gene records in FlyBase already and
we don't like to make duplicate records for what is actually the same
gene unless we can't avoid it. If your genes do not correspond to CGs
then perhaps you could tell me their map location, as this is valuable
information for the genome annotation project.
Thank you very much for your help,
with best wishes,
Rachel.
\----------------------------------------------------------------------
Rachel Drysdale, Ph.D.
FlyBase (Cambridge),
Department of Genetics,
University of Cambridge,
Downing Street, email: rd120@XXXX
Cambridge, CB2 3EH, Ph : 01223-333963
UK. FAX: 01223-333992
FlyBase: http://fly.ebi.ac. uk:7081 /
\----------------------------------------------------------------------
From curtis@XXXX Tue Mar 19  18:07:51  2002
Subject: Re: Helping FlyBase: ADRC-10907
To: 'Rachel Drysdale (Genetics)' <rd120@XXXX>
Hi Rachel,
Our gene pen-1 is CG2855. pen-1 is also recently identified in C. elegans
and was called aph-1 (Goutte et al. 2002, PNAS  99:775 ).
The Drosophila orthologue of the C. Elegans PEN-2 gene resides on
Drosophila Melanogaster Chromosome 2R (55C1-55C5) between the Ote (Otefin \-
CG5581) and sbb (CG5580) genes. There are currently no predicted genes
matching this sequence in the Berkeley Drosophila Genome Project Database.
Its sequence and translation are listed below:
>cdna fasta
TACATATTACATACAATTTACATATAAGTACGAAAAAACTTTCCTGGGCCGGAAACAGAT
TCGAAAACAAAGGAGCAAACACCCACATATTTGAAGAGGATTAATCATGGACATCTCAAA
GGCACCAAATCCGCGAAAACTGGAGCTGTGTCGCAAATACTTCTTTGCTGGCTTTGCATT
TCTGCCCTTTGTGTGGGCCATTAACGTTTGCTGGTTTTTCACGGAGGCCTTCCATAAGCC
ACCATTTTCGGAGCAGAGCCAAATAAAGAGATATGTTATATACTCTGCAGTGGGGACTCT
ATTCTGGCTGATAGTACTAACTGCCTGGATAATAATATTCCAGACAAATCGCACAGCCTG
GGGCGCCACAGCGGACTATATGAGCTTCATCATACCCCTAGGCAGTGCATAGACATAACT
AGATTAATTCGTTAGCAACTAATGATATTAAAAAAGACTTCATTCCTAAACAAAATTAAC
GTTTATTATTAATCCA
>Translation fasta
MDISKAPNPRKLELCRKYFFAGFAFLPFVWAINVCWFFTEAFHKPPFSEQSQIKRYVIYS
AVGTLFWLIVLTAWIIIFQTNRTAWGATADYMSFIIPLGSA
Thanks,
Dan
____________________
Daniel Curtis, Ph.D.
Exelixis, Inc.
170 Harbor Way
P.O. Box 511
South San Francisco, CA 94083-0511
phone: 650-837-8244
Fax: 650-837-7620
curtis@XXXX
DOI
Associated Information
Comments
Associated Files
Other Information
Secondary IDs
    Language of Publication
    English
    Additional Languages of Abstract
    Parent Publication
    Publication Type
    Abbreviation
    Title
    ISBN/ISSN
    Data From Reference
    Genes (4)