Polypeptide Dmel\Gγ30A-PI

General Information
Symbol	Dmel\Gγ30A-PI	Species	D. melanogaster
Annotation Symbol	CG3694-PI	FlyBase ID	FBpp0307603
Associated gene	Dmel\Gγ30A

Length (aa)	64	Theoretical pI	8.49
Predicted MW (kDa)	7.5

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MDRDALKKQIENMKYQASMERWPLSKSIAEMRSFIEENEKNDPLINAPDK KNNPWAEKGKCVIM
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) Gγ30A-RI FBtr0336620 849
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) Gγ30A-RA FBtr0079795 2799 Gγ30A-RB FBtr0079796 1019 Gγ30A-RC FBtr0079797 12225 Gγ30A-RF FBtr0303895 1451 Gγ30A-RG FBtr0309247 1470 Gγ30A-RH FBtr0330019 4742
Other Polypeptides
	Name FlyBase ID Length (aa) Gγ30A-PA FBpp0079395 72 Gγ30A-PB FBpp0079396 72 Gγ30A-PC FBpp0079397 72 Gγ30A-PF FBpp0292898 72 Gγ30A-PG FBpp0301186 72 Gγ30A-PH FBpp0303053 72
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_001162917 DDBJ / EMBL / GenBank • ACZ94207
Synonyms
	Gγ30A-PI
References ( 1 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453]