Polypeptide Dmel\CkIIβ-PG

General Information
Symbol	Dmel\CkIIβ-PG	Species	D. melanogaster
Annotation Symbol	CG15224-PG	FlyBase ID	FBpp0288844
Associated gene	Dmel\CkIIβ

Length (aa)	215	Theoretical pI	5.29
Predicted MW (kDa)	24.8

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MSSSEEVSWVTWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPNYRQAL DMILDLEPEDELEDNPLQSDMTEQAAEMLYGLIHARYILTNRGIAQMIEK YQTGDFGHCPRVYCESQPMLPLGLSDIPGEAMVKTYCPKCIDVYTPKSSR HHHTDGAYFGTGFPHMLFMVHPEYRPKRPTNQFVPRLYGFKIHSLAYQIQ LQAAANFKMPLRAKN
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) CkIIβ-RG FBtr0299569 997
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) CkIIβ-RB FBtr0073558 3121 CkIIβ-RC FBtr0073560 1331 CkIIβ-RD FBtr0073561 966 CkIIβ-RE FBtr0073562 2392 CkIIβ-RF FBtr0100540 1043 CkIIβ-RH FBtr0307896 2376 CkIIβ-RI FBtr0308084 1600 CkIIβ-RJ FBtr0308085 934 CkIIβ-RK FBtr0333204 2006
Other Polypeptides
	Name FlyBase ID Length (aa) CkIIβ-PB FBpp0073403 215 CkIIβ-PC FBpp0073405 215 CkIIβ-PD FBpp0073406 215 CkIIβ-PE FBpp0089135 235 CkIIβ-PF FBpp0099985 215 CkIIβ-PH FBpp0300330 215 CkIIβ-PI FBpp0300427 233 CkIIβ-PJ FBpp0300428 233 CkIIβ-PK FBpp0305406 234
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_511131 DDBJ / EMBL / GenBank • AAF48092
Synonyms
	CkIIβ-PG
References ( 2 )
FlyBase analysis	FlyBase Genome Annotators, 2005, Changes affecting gene model number or type in release 4.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 4.2 of the annotated D.melanogaster genome. [FBrf0182792] FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453]