Subject: Personal communication from Uli Theopold
Dear Cambridge Curators,
Attached (and also included in the body of this email) is a personal
communication from Uli Theopold from Mon, 21 Aug 2000, correlating the
lectins from FBrf0110927 with the Celera predicted genes.
Theopold, U., Rissler, M., Fabbri, M., Schmidt, O., Natori, S.
Insect glycobiology: a lectin multigene family in Drosophila melanogaster.
Biochem. biophys. Res. Commun. 1999 261(3):923--927
_____________________________________________________________________
lectin-24Da AC004279a N/A
lectin-24Db AC004371a CG2958
lectin-24Fa AC004373a N/A
lectin-24Fb AC004373b N/A
lectin-29Ca AC004423a CG17799
accessory gland protein AC004423b CG17797
lectin-21Ca AC004573a CG2826
lectin-21Cb AC004573b CG13686
lectin-22C AC004716a CG15378
lectin-28C AC004723a CG7106
lectin-24A AC005149a CG3410
lectin-30A AC005889a CG17011
lectin-galC1 AC007082a CG9976
lectin-37Da AC007082b CG9978
lectin-37Db AC007082c CG9978
lectin-33A AC007083a CG16834
lectin-44Ca AC007330a CG1656
lectin-46Cb AC007330b CG1652
CK02422a CG7763
Incilarin-like GH10831 CG8343
N/A: not annotated
AC004279a: in genomic clone AE 003578: around positions 44000-43000
AC004373a: in genomic clone AE 003576: around positions 205000-204000
AC004373b: in genomic clone AE003576: around positions 175000-174000
_____________________________________________________________________
Subject: Re: Lectins
Dear Leyla,
I realised there was a problem and looked into the region between our
two predicted lectins (37Da and 37Db), which had been put together
into one lectin with two domains during the annotation. I think a
small exon was missed, which adds a potential signal peptide to the
lectin 37Db (between pos. 240829-241039 in clone AE003662). This exon
is predicted by Genie (96 version, which I used from BDGP from Nomi
Harris) but seems to have been missed by the later version. I
experienced similar problems with lectin 38Da before but the signal
peptide there seems ok.
The predicted sequence after in silico slicing for the lectin 37Db would be:
MVKLLLLFLVCWSALPLESSPLGNRYNLEIGEKQYYISLAKTNWFEASNHCRQNGGFLLN
LESREELELLSPHLHPAYSYWLSINDLGERGVYVSEATGLEAPFLNWSAGEPDNSSGYDR
CVELWLSTTSFQMNDLPCYSSVAFICQLN
The lectin 37Db would correspond to the aminoterminal half of CG9978,
maybe a bit longer since the first stop codon is downstream of the
splice site used in the annotation:
MLKTLVQLFLVVAGFAPGFGYDKYTTHIQNGNPYNLTVDMTPFIKINESY
YVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHW
TSGNDLGKTGTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYS
TEFQLNDRPCHNHASSLFKYICEAPKQETVSIVVWEK
Hope I could help you
Uli
Ulrich Theopold, PhD
Dept. of Molecular Biology
Stockholm University