Open Close
General Information
Symbol
Dmel\CG44085-PJ
Species
D. melanogaster
Annotation Symbol
CG44085-PJ
FlyBase ID
FBpp0306882
Associated gene
Length (aa)
979
Theoretical pI
10.35
Predicted MW (kDa)
107.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MATSTLQSPSPSPSNASVSSKNPQLKRVVYSKYRELLGSYNDKANAIIDTLPAYMVRQDRGFQLSELPVNGDANRNGLEL
SYGQRGGGGSGNGGYEAPACVQNAMMTKDKKPFTYTPGGIDLSQIRSERMAKRLARNAQSEGATGAAQQNRPAQPQSPGG
PGGAASSIGAAAMGMPFQVLPPPPPPPQPQSGKNGTQGASAAPPPPPPQQPSTLAPPTGRLSAPGSPATARKSPTPQRFE
PPPLGFRPEIKIPPNPMAALRKVAPPVEKNTFWKDEYIKDRSKSPLPEVAPAANGGYSSTTSDAVDGPRPSAASVESSYS
PYTPTPQVPPVAKSPPVQYQQPTPPATPPQQQQQQSEQQPATRPEFRSVPMPTSPAVNVYTRQSDSPRSPFEPQQQQQQQ
QPQRSTESPFRFAQQQQQQSPQQRPPTAISPLAQVQQQQQQQLQQQQQQQLQQQQQQQLQQQQQQLQQLQQQQFQQQQLQ
QQQFQQQQLQQQQQQQQQQQQQQQQQQPAVQSVPWRTQRAQPGAQQQQDSHPQPIYNNVQQQQQRSRDVFSPARNETSAA
NTFNSQQQQNQFGGAAKPTNVGSLYIAPLAQPTEPQAQRILLQQQQQSSARDSPMRQLPQQQPQTNQPMRWLSSQPASKE
QAPWARLEENGNVLPSTLRQTTPQPQVVPQQQPQQQQQPQQQQQPTFYQPQLVQGNGYGPTPVSAAPISLQNFGSNPQPG
GLRLQINLNTNGNSSNNTNQSAPRERIIPITLEQTPTYAAAQPNFGGYQNYPPQAQRYPSPNQPTSTSNNTNGNATRLIP
IAIEGGRGGPVSQSPVLLQNDPRSPPIQSKSFRILQKITDTVDDGSGNGDSRQDLQQTPQEAELQRPQFARQMSAQQARN
SPTIEQMRRLQIGQDQQNNHQQSGTPLAWSPQGNGVSAQNRFTQQRYDAPQQQQQYVPPSEQQAPEPKKYTGSAIPSRSF
KILQAMTTPENAGPGQSDL
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0334858
3864
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0334851
3868
FBtr0334852
3768
FBtr0334854
4043
FBtr0334855
3840
FBtr0334853
3282
FBtr0334857
3661
FBtr0334859
3856
FBtr0334860
3418
FBtr0334856
3494
FBtr0334861
3940
FBtr0334862
8804
FBtr0334863
8383
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0306875
836
FBpp0306876
918
FBpp0306878
902
FBpp0306879
942
FBpp0306877
756
FBpp0306881
833
FBpp0306883
979
FBpp0306884
833
FBpp0306880
864
FBpp0306885
1007
FBpp0306886
2381
FBpp0306887
2246
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG44085-PJ
Name Synonyms
Secondary FlyBase IDs
    References (0)