Open Close
General Information
Symbol
Dmel\GABA-B-R3-PH
Species
D. melanogaster
Annotation Symbol
CG3022-PH
FlyBase ID
FBpp0312144
Associated gene
Length (aa)
450
Theoretical pI
8.87
Predicted MW (kDa)
49.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MRIIQPVQGTRYGPWPAVGLRLVLALAWATSAAAAMESSAELQALGYEAIRPGAASISTSSPSSSPPGESASTVTAGGTP
IPPRSDWKYKRTKVKRRQQRLNSHSNLPGSTNASHAHHLLNLPPRQRYLKVNQVFESERRMSPAEMQRNHGKIVLLGLFE
LSTSRGPRPDGLSELGAATMAVEHINRKRLLPGYTLELVTNDTQCDPGVGVDRFFHAIYTQPSTRMVMLLGSACSEVTES
LAKVVPYWNIVQVSFGSTSPALSDRREFPYFYRTVAPDSSHNPARIAFIRKFGWGTVTTFSQNEEVHSLAVNNLVTELEA
ANISCAATITFAATDFKEQLLLLRETDTRIIIGSFSQELAPQILCEAYRLRMFGADYAWILHESMGAPWWPDQRTACSNH
ELQLAVENLIVVSTHNSIVGNNVSYSGLRRLSCPSRCPVLSVLLCVSEMK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0346526
5800
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0078001
5466
FBtr0301439
2359
FBtr0308257
5730
FBtr0343785
5991
FBtr0343786
5633
FBtr0343787
5987
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0077666
1305
FBpp0290654
650
FBpp0300577
1305
FBpp0310350
1305
FBpp0310351
357
FBpp0310352
1305
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
GABA-B-R3-P3-RH
GABA-B-R3-PH
Name Synonyms
Secondary FlyBase IDs
    References (0)