Subject: Re: helping FlyBase
Dear Rachel,
I have gone back to the records of my diploma student
Roland Rutschmann who has isolated nearly ten years ago genomic
clones encoding four prd-type homeodomains. One of them was mapped
to 57B5,6. Although we have isolated a cognate cDNA, it appears
that it was never sequenced. Since the genomic sequence encoding
the homeodomain seems to be interrupted by an intron after amino
acid 44 or, more likely, after amino acid 37,we have only a partial
homeodomain sequence of this gene, which we called PPH17 at the time.
This sequence is different from both 57San and orthopedia/W26:
KKKHRRNRTTFTTYQLHELERAFRKSHYPDVYSREELAMK(VNLPRGS).
I seem to remember that I have compared our sequence a long time ago
with a homeodomain sequence of a gene that was isolated by Bill McGinnis
and that also mapped to 57B5,6. If I remember correctly, his sequence
turned out to be identical with our sequence. Perhaps he knows more
about this gene. Also Uwe Walldorf had a homeodomain gene in this region
whose sequence was however different from ours.
With best regards,
Markus